DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_001259943.1 Gene:Cyp309a1 / 33438 FlyBaseID:FBgn0031432 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:236 Identity:53/236 - (22%)
Similarity:90/236 - (38%) Gaps:56/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLTIVHVAFA--VVYFYLTWYHKY--WDKRGVVTAEPLTILGSYPGILINKSRSLILDVQDVYN 67
            |.||.:.|:..  ::|..|....::  ..|.|:...||..::|:...|:..|::....|..|.||
 Worm     4 LILTSILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYDWYN 68

  Fly    68 K-YKDKYRTVGTFITRQPQLLVLDPALAHEILVDKFSHFRDTITSSFVGHNP------DDKYVAG 125
            | :|....|.|.:...|..:.:.:.....|:.:..||:|.|......:..|.      .:.|.:|
 Worm    69 KLHKQFGETFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTYESG 133

  Fly   126 --------SPFFSAGDKWKRLRSENVGGLTPSRLKMAYSIWEQ---SGRKLVEYIE--------- 170
                    :|.||.| |.|.:. |.:    .|::.:...|.::   ||:|...|.:         
 Worm   134 WKHTRSAIAPIFSTG-KMKAMH-ETI----HSKVDLFLEILKEKASSGQKWDIYDDFQGLTLDVI 192

  Fly   171 ---------RARREQGDIIETRDLAYRFTANAMADFIWGID 202
                     ..:|::.||         |..|| ..||..||
 Worm   193 GKCAFAIDSNCQRDRNDI---------FYVNA-RKFITNID 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a1NP_001259943.1 p450 49..481 CDD:299894 42/190 (22%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 39/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.