DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a1 and Cyp3a13

DIOPT Version :10

Sequence 1:NP_608688.3 Gene:Cyp309a1 / 33438 FlyBaseID:FBgn0031432 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus


Alignment Length:32 Identity:9/32 - (28%)
Similarity:16/32 - (50%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LGTYTGTANDGLTYHK-GMEFTTKDRDNDGHI 119
            :..|.....|..::|. |:||..:|.:.||.:
Mouse    24 MNRYVTDRFDSQSFHTIGVEFLNRDLEIDGRL 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a1NP_608688.3 CYP6-like 71..480 CDD:410679 9/32 (28%)
Cyp3a13NP_031845.1 CYP3A 67..492 CDD:410743
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.