DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oaf and OAF

DIOPT Version :9

Sequence 1:NP_787963.2 Gene:oaf / 33435 FlyBaseID:FBgn0011818 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_848602.1 Gene:OAF / 220323 HGNCID:28752 Length:273 Species:Homo sapiens


Alignment Length:274 Identity:106/274 - (38%)
Similarity:153/274 - (55%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SRAFLWFLLCNLVMNADAFAHSQLLINVQNQGGEVIQESITSNIGEDLITLEFQKTDGTLITQVI 123
            :|..|..||..|.......|.::|.:.|:...|:|.:||:.::...|.|:||.:|.||||::...
Human     9 ARPALLLLLPLLAPLLGTGAPAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTA 73

  Fly   124 DFRNEVQILKALVLGEEERGQSQYQVMCFATKFNKGDFISSAAMAKLRQKNPHTIRTPEEDKGRE 188
            ||:.:|::.:||:|||.|:||||:|.:||.|:....:.|.|.||||||||||..:|..||.:|.|
Human    74 DFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLE 138

  Fly   189 TFTMSSWVQLNRSLPITRHLQGLCAEAMDATYVRDVDLKAWAELPGSSISSLEAATEKFPDTLST 253
            ...|...|..::...::.||..:||||:||.|.|..|::.|.| .|...|..||..:........
Human   139 HLHMDVAVNFSQGALLSPHLHNVCAEAVDAIYTRQEDVRFWLE-QGVDSSVFEALPKASEQAELP 202

  Fly   254 RCNEVSSLWAPCLCNLETCIGWYPCGLKYCKGKGVAGADSSGAQQQAQPTNYRCGIKTCRKCTQF 318
            ||.:|.....||:|.....:.||||.||||..:.             :||.|:|||::|:|...|
Human   203 RCRQVGDHGKPCVCRYGLSLAWYPCMLKYCHSRD-------------RPTPYKCGIRSCQKSYSF 254

  Fly   319 TYYVRQKQQCLWDE 332
            .:||.|:|.|||||
Human   255 DFYVPQRQLCLWDE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oafNP_787963.2 OAF 81..332 CDD:291602 98/250 (39%)
OAFNP_848602.1 OAF 31..268 CDD:291602 98/250 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146965
Domainoid 1 1.000 201 1.000 Domainoid score I3018
eggNOG 1 0.900 - - E1_28PQY
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14334
Inparanoid 1 1.050 203 1.000 Inparanoid score I3754
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007195
OrthoInspector 1 1.000 - - oto88699
orthoMCL 1 0.900 - - OOG6_108566
Panther 1 1.100 - - LDO PTHR13423
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4916
SonicParanoid 1 1.000 - - X5307
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.