DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slh and AT4G31740

DIOPT Version :9

Sequence 1:NP_001137769.2 Gene:Slh / 33434 FlyBaseID:FBgn0264978 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_194902.1 Gene:AT4G31740 / 829302 AraportID:AT4G31740 Length:171 Species:Arabidopsis thaliana


Alignment Length:197 Identity:64/197 - (32%)
Similarity:98/197 - (49%) Gaps:36/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 DKLRLYIIYFICAQQLPESEQERLKEALQAAGCDLTALAYVQRWKGIMNRSPSISQATQYEGGGT 500
            ||||..|:|.:..:.:.:||.|.::.||                       ||...|::     :
plant     2 DKLRFAIMYLLSLETINQSEVEAVEAAL-----------------------PSADSASR-----S 38

  Fly   501 KTVSMFTKLVSQGSSFVMEGVKNLVVKRHNLPVTKITEQVMECRSNAETDDYLYLDPKLLKGGEV 565
            ..|....||..|..|.|..|||||:.....|||.:..|.:.:.:.|.|||.||.||.:..|.|.:
plant    39 NIVDWAEKLYGQSISAVTPGVKNLLSSDQQLPVARTVEALTDGKPNPETDSYLILDARASKSGSI 103

  Fly   566 LPKN---RAPFQDAVVFMVGGGNYIEYQNLVDFIKQKQTSNVQRRIIYGASTLTNARQFLKELSA 627
              .|   :.||::|:|||:||||||||.:|.:..::::..|   .|||||:.:....:.:::|..
plant   104 --DNSYVKGPFEEAIVFMIGGGNYIEYSSLQELSQRQEMVN---NIIYGATEILTGTELVEQLGE 163

  Fly   628 LG 629
            ||
plant   164 LG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlhNP_001137769.2 Sec1 1..630 CDD:301618 64/197 (32%)
AT4G31740NP_194902.1 Sec1 <1..154 CDD:417708 61/184 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004255
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.