DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and GDF15

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_004855.2 Gene:GDF15 / 9518 HGNCID:30142 Length:308 Species:Homo sapiens


Alignment Length:362 Identity:87/362 - (24%)
Similarity:132/362 - (36%) Gaps:93/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 GHELDSVN-------------IPKPGLLTKSANTVRSF-----THKDSKIDDRFPHHHRFRLHFD 308
            |.||.:||             :|..|.|:.:..:..||     .|.:..         |||    
Human     3 GQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDS---------RFR---- 54

  Fly   309 VKSIPADEKLKAAELQLTRDALSQQVVASRSS-ANRTRYQVLVYDITRVGVRGQRE--------- 363
                   |..|..|..|||...:|....|.:. ......::|..:: |:|..|...         
Human    55 -------ELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEV-RLGSGGHLHLRISRAALP 111

  Fly   364 ---PSYLLLDTKTVRLNSTDTVSLDVQPAVDRW--LASPQRNYGLLVEVRTVRSLKPAPHHHVRL 423
               |....|.....||:.|.:.|.||...:.|.  ||.||   ...:.:|    |.|.|....:|
Human   112 EGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQ---APALHLR----LSPPPSQSDQL 169

  Fly   424 RRSADEAHERWQ-HKQPLLFTYTDDGRHKARSIRDVSGGEGGGKGGRN-KRQPRRPTRRKNHDDT 486
            ...:..|..:.: |.:|    ....||.:||:              || ...|..|.|      .
Human   170 LAESSSARPQLELHLRP----QAARGRRRARA--------------RNGDHCPLGPGR------C 210

  Fly   487 CRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTN-HAVVQTLVNNMNPGKVPK 550
            ||.|::.....|:||.||:::|.......|.|.||    ..|.:.| ||.::|.::.:.|..||.
Human   211 CRLHTVRASLEDLGWADWVLSPREVQVTMCIGACP----SQFRAANMHAQIKTSLHRLKPDTVPA 271

  Fly   551 ACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGC 587
            .||||...:.:.::...| :.|.|:.|.::....|.|
Human   272 PCCVPASYNPMVLIQKTD-TGVSLQTYDDLLAKDCHC 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 47/215 (22%)
TGFB 487..588 CDD:214556 31/102 (30%)
GDF15NP_004855.2 MscS_TM <23..>147 CDD:331130 30/144 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..177 5/28 (18%)
TGFB 211..308 CDD:214556 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.