DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Inhbe

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_114003.2 Gene:Inhbe / 83711 RGDID:621196 Length:350 Species:Rattus norvegicus


Alignment Length:374 Identity:94/374 - (25%)
Similarity:153/374 - (40%) Gaps:76/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LVEIEK-SLLSLFNMKRPPKIDR--SKIIIPEPMKKLYAEIM--GHELDSVNIPKPGLLTKSANT 282
            ::|:.| .:|...::...|:|.|  .:..:...:::|....|  |:....::....  :.||.:|
  Rat    43 VLELAKQQILEGLHLTSRPRITRPLPQAALTRALRRLQPRSMVPGNREKVISFATS--IDKSTST 105

  Fly   283 VRS-FTHKDSKIDDRFPHHHRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTRY 346
            .|| .|.:.|.:.....:|.|..||.. .|.||...|:......||...|:..:|...:.: :.:
  Rat   106 YRSVLTFQLSPLWSHHLYHARLWLHVP-PSFPATLYLRIFGCGTTRCRGSRTFLADYQTTS-SGW 168

  Fly   347 QVLVYDITRVGVRGQRE-PSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRNYGLLVEVRTV 410
            ..|.  :...|:|.:.. .:.|.|:.:.:.|||| |..|   |.:....|..||.:   :|:: :
  Rat   169 HALT--LPSSGLRSEESGVTKLQLEFRPLDLNST-TARL---PRLLLDTAGQQRPF---LELK-I 223

  Fly   411 RSLKPAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRHKARSIRDVSGGEGGGKGGRNKRQPR 475
            |:.:|                                               |.|:..|     |
  Rat   224 RANEP-----------------------------------------------GAGRARR-----R 236

  Fly   476 RPTRRKNHDDTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADH--FNSTNHAVVQT 538
            .||........|||.. ||||.::||.|||:.|.||...||.|:||..||..  ..::.|:.|.:
  Rat   237 TPTCESETPLCCRRDH-YVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS 300

  Fly   539 LVNNMNPGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGC 587
            |:...||.....:|||||....:::|||:....||..:..:|.|..|||
  Rat   301 LLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 46/225 (20%)
TGFB 487..588 CDD:214556 42/103 (41%)
InhbeNP_114003.2 TGF_beta_INHBC_E 247..350 CDD:381676 42/104 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.