DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and TGFB3

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001316868.1 Gene:TGFB3 / 7043 HGNCID:11769 Length:412 Species:Homo sapiens


Alignment Length:440 Identity:99/440 - (22%)
Similarity:152/440 - (34%) Gaps:139/440 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 IKDKLK----PDPSTLVEIEKSLLSLFNMKRPPKIDRSKIIIPEPMKKLYAEIMGHELDSVNIPK 272
            |..||:    |:|:.:..:...:|:|:|..|                :|..|:.|...:...   
Human    47 ILSKLRLTSPPEPTVMTHVPYQVLALYNSTR----------------ELLEEMHGEREEGCT--- 92

  Fly   273 PGLLTKSANTVRSF----THKDSKIDDRFPHHHR-----------FRLHFDVKSIPADE-KLKAA 321
                  ..||...:    .||...|.....|:..           ||  |:|.|:..:. .|..|
Human    93 ------QENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFR--FNVSSVEKNRTNLFRA 149

  Fly   322 ELQLTRDALSQQVVASRSSANRTRYQVLVYDITRVG--VRGQREPSYLLLDTKTVRLNSTDTVSL 384
            |.::.|        ....|:.|...::.::.|.|..  :..||......|.|:    .:.:.:|.
Human   150 EFRVLR--------VPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTR----GTAEWLSF 202

  Fly   385 DVQPAVDRWLASPQRNYGLLVEVRTVRSLKPAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGR 449
            ||...|..||...:.|.||.:.:.       .|.|                       |:..:|.
Human   203 DVTDTVREWLLRRESNLGLEISIH-------CPCH-----------------------TFQPNGD 237

  Fly   450 -----HKARSIR----DVSGGEGGGKGGRNKRQ--------------------PRRPTRRK---- 481
                 |:...|:    |.....|.|..||.|:|                    |.:..:||    
Human   238 ILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRAL 302

  Fly   482 -------NHDDTCRRHSLYVDF-SDVGWDDWIVAPLGYDAYYCHGKCPF-PLADHFNSTNHAVVQ 537
                   |.::.|....||:|| .|:|| .|:..|.||.|.:|.|.||: ..||    |.|:.|.
Human   303 DTNYCFRNLEENCCVRPLYIDFRQDLGW-KWVHEPKGYYANFCSGPCPYLRSAD----TTHSTVL 362

  Fly   538 TLVNNMNPGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGC 587
            .|.|.:||......||||..|:.:.:||...: |..::....|.|..|.|
Human   363 GLYNTLNPEASASPCCVPQDLEPLTILYYVGR-TPKVEQLSNMVVKSCKC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 41/236 (17%)
TGFB 487..588 CDD:214556 38/103 (37%)
TGFB3NP_001316868.1 TGFb_propeptide 24..230 CDD:395559 45/228 (20%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 38/106 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.