DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and BMP3

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001192.4 Gene:BMP3 / 651 HGNCID:1070 Length:472 Species:Homo sapiens


Alignment Length:435 Identity:106/435 - (24%)
Similarity:169/435 - (38%) Gaps:113/435 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 IPEPMKKLY--------AEIMGHELDSVNIP-KPGLLTKSANTVRSFTHKDSKIDDR-------- 296
            :.|.|.:||        |...| .|:..:.| :|.|| :..||||||....::..:|        
Human    56 VSEHMLRLYDRYSTVQAARTPG-SLEGGSQPWRPRLL-REGNTVRSFRAAAAETLERKGLYIFNL 118

  Fly   297 ---------------------------FP-----HHHRFRLHFDVKSIPADEKLKAAELQLT--- 326
                                       .|     .||..|.|..:.......|....:.||.   
Human   119 TSLTKSENILSATLYFCIGELGNISLSCPVSGGCSHHAQRKHIQIDLSAWTLKFSRNQSQLLGHL 183

  Fly   327 --------RDA---LSQQVVASRSSANRTRYQVLVYDITRVGVRGQREPS--------YLLLDTK 372
                    ||.   ||:.:......|......::.::||.   :|::.|.        |:|:...
Human   184 SVDMAKSHRDIMSWLSKDITQLLRKAKENEEFLIGFNITS---KGRQLPKRRLPFPEPYILVYAN 245

  Fly   373 TVRLNSTDTVSLDVQ-------PAVDRWLASPQRNYGLLVEVRTVRS---LKPAPHHHVRLRRSA 427
            ...::..::|...:|       ..|.:|  .......|.:|.|..||   |.|..::.:......
Human   246 DAAISEPESVVSSLQGHRNFPTGTVPKW--DSHIRAALSIERRKKRSTGVLLPLQNNELPGAEYQ 308

  Fly   428 DEAHERWQHKQP---LLFTYTDDGRHKARSIRDVSGGEGGGKGGRNK-------RQPRRPTRRKN 482
            .:..|.|:.::|   |.....:..::|.:.          .||...|       .|..:..|||.
Human   309 YKKDEVWEERKPYKTLQAQAPEKSKNKKKQ----------RKGPHRKSQTLQFDEQTLKKARRKQ 363

  Fly   483 --HDDTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMN- 544
              ....|.|..|.|||:|:||.:||::|..:|||||.|.|.||:......:|||.:|::|..:. 
Human   364 WIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGV 428

  Fly   545 -PGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGCR 588
             || :|:.||||.::.|:::|:.::...||||.|..|||..|.||
Human   429 VPG-IPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 52/278 (19%)
TGFB 487..588 CDD:214556 44/102 (43%)
BMP3NP_001192.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..350 6/39 (15%)
TGF_beta_BMP3 363..472 CDD:381663 44/109 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.