DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and inha

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001027522.1 Gene:inha / 613114 XenbaseID:XB-GENE-853910 Length:371 Species:Xenopus tropicalis


Alignment Length:137 Identity:36/137 - (26%)
Similarity:52/137 - (37%) Gaps:39/137 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RNKRQP-----------RRPTRRKNHDDTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPF 522
            ||:|..           :||.......|.|.|.||.:.|.::||..|||.|..:..:||||.|  
 Frog   255 RNRRSGVPWSPSALEFLQRPPESGAGSDHCHRGSLNITFEELGWGQWIVHPGSFQFHYCHGTC-- 317

  Fly   523 PLADHFNSTNHAVVQTLVNNMNPGKVPKACC--VPTQLDSVAMLYLNDQSTVVLKNYQEMTVVG- 584
                   |..|.:...|    :.|.    ||  :|:.:.|:.:....|...    :|:..||.. 
 Frog   318 -------SPTHGLTPAL----HWGH----CCAALPSTMKSLRVTTTTDGGF----SYRYETVPNI 363

  Fly   585 ----CGC 587
                |.|
 Frog   364 LTQDCAC 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078
TGFB 487..588 CDD:214556 30/108 (28%)
inhaNP_001027522.1 TGF_beta 284..370 CDD:306518 29/106 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.