DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Bmp15

DIOPT Version :10

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_067702.1 Gene:Bmp15 / 59302 RGDID:70990 Length:391 Species:Rattus norvegicus


Alignment Length:114 Identity:39/114 - (34%)
Similarity:61/114 - (53%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 PTRRKNH--DDTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTL 539
            |::.::.  ::.|..|...|.|..:|||.||:||..|...||.|.|...|....||.|||::|:|
  Rat   278 PSQEQDRSVNNQCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICTGVLPYGLNSPNHAIIQSL 342

  Fly   540 VNNMNPGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGCR 588
            ||.:....||:..|||.:...:::|.:....:::.|.|:.|....|.||
  Rat   343 VNELVNRSVPQLSCVPYKFLPMSILLIEANGSILYKEYEGMIAQSCTCR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:480997
TGF_beta_DPP 480..588 CDD:381662 36/109 (33%)
Bmp15NP_067702.1 TGF_beta_SF 288..391 CDD:477357 36/102 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.