DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Bmp15

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_067702.1 Gene:Bmp15 / 59302 RGDID:70990 Length:391 Species:Rattus norvegicus


Alignment Length:114 Identity:39/114 - (34%)
Similarity:61/114 - (53%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 PTRRKNH--DDTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTL 539
            |::.::.  ::.|..|...|.|..:|||.||:||..|...||.|.|...|....||.|||::|:|
  Rat   278 PSQEQDRSVNNQCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICTGVLPYGLNSPNHAIIQSL 342

  Fly   540 VNNMNPGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGCR 588
            ||.:....||:..|||.:...:::|.:....:::.|.|:.|....|.||
  Rat   343 VNELVNRSVPQLSCVPYKFLPMSILLIEANGSILYKEYEGMIAQSCTCR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078
TGFB 487..588 CDD:214556 36/100 (36%)
Bmp15NP_067702.1 TGF_beta 288..390 CDD:278448 36/101 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.