DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and bmp7.1

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_989197.1 Gene:bmp7.1 / 394805 XenbaseID:XB-GENE-486014 Length:424 Species:Xenopus tropicalis


Alignment Length:409 Identity:125/409 - (30%)
Similarity:194/409 - (47%) Gaps:80/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 EIEKSLLSLFNM-KRP-PKIDRSKIIIPEPMKKLY--AEIMGHELDSVNIP-KPGLLTK------ 278
            |:::.:||:..: .|| |.:...:...|..|..||  ..:...|.:..:.| ||...|:      
 Frog    49 EMQREILSILGLPHRPRPHLYGKQNSAPMFMLDLYNAMTVDEEEAEGFSYPYKPIFTTQGPPLAS 113

  Fly   279 --------SANTVRSFTH---KDSKIDDRFPHHHRFRLHFDVKSIPADEKLKAAELQLTRDALSQ 332
                    .|:.|.||.:   .|.:...:..||..||  ||:..||..|.:.|||.::.:|.:.:
 Frog   114 QQDSNFLNDADMVMSFVNLVEHDKEFFHQRRHHREFR--FDIAKIPEGEAVTAAEFRIYKDYIRE 176

  Fly   333 QVVASRSSANRTRYQVLVYDITRVGVRGQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASP 397
            :.      .|.| :|:.||.:.:  ....|:.....||::|:.......:..|:....:.|:.:|
 Frog   177 RF------ENET-FQISVYQVLQ--EHQGRDSDLYELDSRTIWAAEEGWLVFDITTTSNHWVVNP 232

  Fly   398 QRNYGLLVEVRTV--RSLKP---------APHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRHK 451
            |.|.||.:.|.::  :|:.|         .||                 :|||.:..:.......
 Frog   233 QHNLGLQLSVESIDGQSINPKMAGLIGTNGPH-----------------NKQPFMVAFFKATEIH 280

  Fly   452 ARSIRDVSGGEGGGKGGRNKRQPRRPTRRK-------------NHDDTCRRHSLYVDFSDVGWDD 503
            .||||     ..||| .||:.:.:.|..::             :....|::|.|||.|.|:||.|
 Frog   281 LRSIR-----SAGGK-HRNQNRSKAPKSQEALRVSNIAENSSTDQKQACKKHELYVSFKDLGWQD 339

  Fly   504 WIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMNPGKVPKACCVPTQLDSVAMLYLND 568
            ||:||.||.|:||.|:|.|||..:.|:||||:|||||:.:||..|||.||.||||:.:::||.:|
 Frog   340 WIIAPEGYAAFYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNPISVLYFDD 404

  Fly   569 QSTVVLKNYQEMTVVGCGC 587
            .|.|:||.|:.|.|..|||
 Frog   405 SSNVILKKYRNMVVRACGC 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 57/251 (23%)
TGFB 487..588 CDD:214556 58/101 (57%)
bmp7.1NP_989197.1 TGFb_propeptide 31..273 CDD:366248 57/251 (23%)
TGF_beta_BMP7 318..424 CDD:381667 58/106 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.