DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and BMP8A

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_861525.2 Gene:BMP8A / 353500 HGNCID:21650 Length:402 Species:Homo sapiens


Alignment Length:401 Identity:122/401 - (30%)
Similarity:186/401 - (46%) Gaps:80/401 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 EIEKSLLSLFNM------KRPPKIDRSKIIIPEPMKKLYAEIMGHELDSVNIPKPGLLTKSANTV 283
            ::::.:|::..:      :.||...|.....|..|..||..:.|.: |....|....|.: |:.|
Human    43 DVQREILAVLGLPGRPRPRAPPAASRLPASAPLFMLDLYHAMAGDD-DEDGAPAEQRLGR-ADLV 105

  Fly   284 RSFTH---KDSKIDDRFPHHHRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTR 345
            .||.:   :|..:..:.||...||  ||:..|||.|.:.|||.::.:       |.|....|||.
Human   106 MSFVNMVERDRALGHQEPHWKEFR--FDLTQIPAGEAVTAAEFRIYK-------VPSIHLLNRTL 161

  Fly   346 YQVLVYDITRVGVRGQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRNYG--LLVEVR 408
            : |.::.:  |..:..||.....||.:|:|......:.|||..|.|.||....::.|  |.||..
Human   162 H-VSMFQV--VQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETE 223

  Fly   409 TVRSLKP---------APHHHVRLRRSADEAHERWQHKQPLLFTY---TDDGRHKARSIRDVSGG 461
            ...|:.|         ||                 :.:||.:.|:   :.......|::|.:   
Human   224 DGHSVDPGLAGLLGQRAP-----------------RSQQPFVVTFFRASPSPIRTPRAVRPL--- 268

  Fly   462 EGGGKGGRNKRQPRRPTR--------------RKNHD-DTCRRHSLYVDFSDVGWDDWIVAPLGY 511
                    .:|||::...              |.:|. ..||||.|||.|.|:||.||::||.||
Human   269 --------RRRQPKKSNELPQANRLPGIFDDVRGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGY 325

  Fly   512 DAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMNPGKVPKACCVPTQLDSVAMLYLNDQSTVVLKN 576
            .||||.|:|.|||....|:||||::|:||:.|.|..||||||.||:|.:.::||.:..:.|:|:.
Human   326 SAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPNAVPKACCAPTKLSATSVLYYDSSNNVILRK 390

  Fly   577 YQEMTVVGCGC 587
            ::.|.|..|||
Human   391 HRNMVVKACGC 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 60/238 (25%)
TGFB 487..588 CDD:214556 54/101 (53%)
BMP8ANP_861525.2 TGFb_propeptide 33..251 CDD:279078 60/238 (25%)
TGF_beta 299..401 CDD:278448 52/101 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.