DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and inhbaa

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001349183.1 Gene:inhbaa / 30072 ZFINID:ZDB-GENE-000210-21 Length:395 Species:Danio rerio


Alignment Length:148 Identity:51/148 - (34%)
Similarity:72/148 - (48%) Gaps:29/148 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 GGRNKRQPRRP---------------TRRKNHDD------TCRRHSLYVDFSDVGWDDWIVAPLG 510
            ||..:.|..||               .|||...:      .|.:...||:|.|:||:|||:||.|
Zfish   249 GGSEREQSHRPFLMAVVRQMDELSLRRRRKRGLECDGKARVCCKRQFYVNFKDIGWNDWIIAPSG 313

  Fly   511 YDAYYCHGKCPFPLAD------HFNSTNHAVVQTLVNNMNPGKVPKACCVPTQLDSVAMLYLNDQ 569
            |.|.||.|.|...:|.      .|:||  .:....:...:|....|:|||||:|.:::|||.|::
Zfish   314 YHANYCEGDCASNVASITGNSLSFHST--VISHYRIRGYSPFTNIKSCCVPTRLRAMSMLYYNEE 376

  Fly   570 STVVLKNYQEMTVVGCGC 587
            ..:|.|:.|.|.|..|||
Zfish   377 QKIVKKDIQNMIVEECGC 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078
TGFB 487..588 CDD:214556 43/107 (40%)
inhbaaNP_001349183.1 TGFb_propeptide 67..263 CDD:307025 5/13 (38%)
TGF_beta 290..394 CDD:306518 41/105 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.