DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Gdf11

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_058899.1 Gene:Gdf11 / 29454 RGDID:2673 Length:405 Species:Rattus norvegicus


Alignment Length:427 Identity:99/427 - (23%)
Similarity:154/427 - (36%) Gaps:85/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 ANAKAIIAEQGPSTYSKEALIKDKLKPDPS--------------TLVEIEKSLLSLFNMKRPPKI 242
            |.|.|..|..|....|:.|   ....|:|.              .|..|:..:||...:|..|.|
  Rat    32 AAAAAAAAGVGGERSSRPA---PSAAPEPDGCPVCVWRQHSRELRLESIKSQILSKLRLKEAPNI 93

  Fly   243 DRS--KIIIPE--PMKKL--YAEIMGHELDSVNIPKPGLLTKSANTVRSFTHK-DSKID-DRFPH 299
            .|.  |.::|:  |::::  ..:..|..|...:..:......:..||.|...: |..:. |..|.
  Rat    94 SREVVKQLLPKAPPLQQILDLHDFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPL 158

  Fly   300 HHRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTRYQVLVYDITRVGVRGQREP 364
            ...|  ||..| :...:.|||......|.......|..:.    .|.:.|..:.|..|..|.|. 
  Rat   159 CCHF--HFSPK-VMFTKVLKAQLWVYLRPVPRPATVYLQI----LRLKPLTGEGTAGGGGGGRR- 215

  Fly   365 SYLLLDTKTVRLNSTD--TVSLDVQPAVDRWLASPQRNYGLLVEV-------RTVRSLKPAPHHH 420
             ::.:.:..:.|:|..  ..|:|.:..:..|...||.|:|:.:..       ..|.||.|..   
  Rat   216 -HIRIRSLKIELHSRSGHWQSIDFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGA--- 276

  Fly   421 VRLRRSADEAHERWQHKQPLLFTYTDDGRHKARSIRDVSGGEGGGKGGRNKRQPRRPTRRKNHDD 485
                                      :|.|....:|.:...:      |::|.........:.:.
  Rat   277 --------------------------EGLHPFMELRVLENTK------RSRRNLGLDCDEHSSES 309

  Fly   486 TCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMNPGKVPK 550
            .|.|:.|.|||...|| |||:||..|.|.||.|:|.:.....:..|:      ||...||.....
  Rat   310 RCCRYPLTVDFEAFGW-DWIIAPKRYKANYCSGQCEYMFMQKYPHTH------LVQQANPRGSAG 367

  Fly   551 ACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGC 587
            .||.||::..:.|||.||:..::......|.|..|||
  Rat   368 PCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 46/235 (20%)
TGFB 487..588 CDD:214556 38/101 (38%)
Gdf11NP_058899.1 TGFb_propeptide 59..283 CDD:307025 49/261 (19%)
TGFB 311..405 CDD:214556 38/101 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.