DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Lefty2

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001007557.1 Gene:Lefty2 / 289316 RGDID:1359679 Length:366 Species:Rattus norvegicus


Alignment Length:407 Identity:79/407 - (19%)
Similarity:138/407 - (33%) Gaps:123/407 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 EIEKSLLSLFNMKRPPKIDRSKI---IIPEPMKKLYAEIMGHELDSVNIPKPGLLTKSANTVRSF 286
            ::..|||....:.:.|.:||..:   .||..:...|..::                       ..
  Rat    26 QVLSSLLKQLQLSQAPVLDRVDVEGMAIPTHVSSQYVALL-----------------------QG 67

  Fly   287 THKDSKIDDRFPHHHR-------------FRLHFDVKS-IPADEKLKAAELQLTRDALSQQVV-- 335
            :|.|.....||..:.|             ..|.|.::. :|.:.:|..|.|:|.::.:.:..:  
  Rat    68 SHADRSRGKRFSQNFREVAGRFLVSETSSHLLVFGMEQRLPPNSELVQAMLRLFQEPVPRTALRR 132

  Fly   336 ASRSSANRTRYQVLVYDITRVGVRGQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRN 400
            ..|...:..:.:|.: :..||...|....:  |:|::.|.:..:.....||..||:.|....:..
  Rat   133 LERLPPHSAQARVTI-EWLRVREDGSNRTA--LIDSRLVSIYESGWKVFDVTEAVNFWQQLSRPR 194

  Fly   401 YGLLVEVRTVRS-LKPAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRHKAR------SIRDV 458
            ..||::|...|. |.|......:|.|.|.:.              |.||:.:.:      .::|.
  Rat   195 QPLLLQVSVQREHLGPGTWSAHKLVRFAAQG--------------TPDGKGEPQLELHTLDLKDY 245

  Fly   459 SGGEGGGKGGRNKRQPRRPTRRKNHDDTCRRHSLYVDFSDVGW-DDWIVAPLGYDAYYCHGKC-- 520
                    |.:....|..|.   .....|.|..:|:|...:.| ::||:.|.|:..|.|.|.|  
  Rat   246 --------GAQGNCDPEAPV---TEGTRCCRKEMYLDLQGMKWAENWILEPPGFLIYECVGSCRQ 299

  Fly   521 ---------PFPLADHFNSTNHAVVQTLVNNMNPGKVPKACCVPTQLDSVAML--YLNDQST--- 571
                     ||                    :.|.:     ||.:::.|:.|:  ...|..|   
  Rat   300 LPESLTIGWPF--------------------LGPRQ-----CVASEMTSLPMIVSIKEDGKTRPQ 339

  Fly   572 -VVLKNYQEMTVVGCGC 587
             |.|.|   |.|..|.|
  Rat   340 VVSLPN---MRVQTCSC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 43/238 (18%)
TGFB 487..588 CDD:214556 29/119 (24%)
Lefty2NP_001007557.1 TGF-beta propeptide 45..231 41/225 (18%)
TGFb_propeptide <68..211 CDD:279078 30/145 (21%)
TGF_beta 261..353 CDD:278448 28/119 (24%)
transforming growth factor beta-like domain 263..353 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.