DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and AMH

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_000470.3 Gene:AMH / 268 HGNCID:464 Length:560 Species:Homo sapiens


Alignment Length:338 Identity:78/338 - (23%)
Similarity:115/338 - (34%) Gaps:95/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 HFDVKSIPADEKLKAAELQ------------LTRDALSQQVVASRSSANRTRYQVLVYDITRV-- 356
            |..:.::|......:|||:            |||...:.:|..:|:||.|     |..|...:  
Human   263 HGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRALRVPPARASAPR-----LALDPDALAG 322

  Fly   357 ---GVRGQREPSYL--LLDTK---TVRLNSTDTVSLDVQPAVD----RWLASPQRN-----YGLL 404
               |:....:|:.|  |||.:   .:.|..|...:.|..|..|    .|..:..|.     ....
Human   323 FPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDPAPLHDPTSAPWATALARRVAAELQAAA 387

  Fly   405 VEVRTVRSLKPAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRHKARSIRDVSGGEGG-G--- 465
            .|:|::..|.||                    ..|||          ||.:....||.|| |   
Human   388 AELRSLPGLPPA--------------------TAPLL----------ARLLALCPGGPGGLGDPL 422

  Fly   466 ---------KG------GRNKRQPRRPTRRKN---HDDTCRRHSLYVDFSDVGWDDWIVAPLGYD 512
                     :|      ||:.|.|.|..|...   .|..|....|.||...   :..::.|..|.
Human   423 RALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRA---ERSVLIPETYQ 484

  Fly   513 AYYCHGKCPFPLADHFNST--NHAVVQTLVNNMNPGKVPKACCVPTQLDSVAMLYLNDQSTVVLK 575
            |..|.|.|.:|.:|. |..  ||.|:...:...........|||||......::.|::: .:...
Human   485 ANNCQGVCGWPQSDR-NPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSEE-RISAH 547

  Fly   576 NYQEMTVVGCGCR 588
            :...|....||||
Human   548 HVPNMVATECGCR 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 36/168 (21%)
TGFB 487..588 CDD:214556 25/102 (25%)
AMHNP_000470.3 AMH_N 77..398 CDD:309721 31/139 (22%)
TGFB 462..560 CDD:214556 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.