DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Tgfb3

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_037306.1 Gene:Tgfb3 / 25717 RGDID:3851 Length:412 Species:Rattus norvegicus


Alignment Length:410 Identity:103/410 - (25%)
Similarity:159/410 - (38%) Gaps:79/410 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 IKDKLK----PDPSTLVEIEKSLLSLFNMKR----PPKIDRSKIIIPEPMKKLYAEIMGHELDSV 268
            |..||:    |:||.:..:...:|:|:|..|    ....:|.:....|..:..|.....|:.|.:
  Rat    47 ILSKLRLTSPPEPSVMTHVPYQVLALYNSTRELLEEMHGEREEGCTQETSESEYYAKEIHKFDMI 111

  Fly   269 NIPKPGLLTKSANTV--RSFTHKDSKIDDRFPHHHRFRLHFDVKSIPAD-EKLKAAELQLTRDAL 330
            .    ||...:...|  :..|   ||:         ||  |:|.|:..: ..|..||.::.|   
  Rat   112 Q----GLAEHNELAVCPKGIT---SKV---------FR--FNVSSVEKNGTNLFRAEFRVLR--- 155

  Fly   331 SQQVVASRSSANRTRYQVLVYDITRVG--VRGQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRW 393
                 ....|:.||..::.::.|.|..  :..||......|.|:    .:.:.:|.||...|..|
  Rat   156 -----VPNPSSKRTEQRIELFQILRPDEHIAKQRYIGGKNLPTR----GTAEWLSFDVTDTVREW 211

  Fly   394 LASPQRNYGLLVEVRTVRSLKPAPHHHVRLRRS-ADEAHERWQHKQPLLFTYTDDGR-------- 449
            |...:.|.||.:.:.       .|.|..:.... .:..||..:.|...:....|.||        
  Rat   212 LLRRESNLGLEISIH-------CPCHTFQPNGDILENVHEVMEIKFKGVDNEDDHGRGDLGRLKK 269

  Fly   450 ----HKARSI-------RDVSGGEGGGKGGRNKRQPRRPTRRKNHDDTCRRHSLYVDF-SDVGWD 502
                |....|       |..|.|:|   |.|.||........:|.::.|....||:|| .|:|| 
  Rat   270 QKDHHNPHLILMMIPPHRLDSPGQG---GQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGW- 330

  Fly   503 DWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMNPGKVPKACCVPTQLDSVAMLYLN 567
            .|:..|.||.|.:|.|.||:..:   :.|.|:.|..|.|.:||......||||..|:.:.:||..
  Rat   331 KWVHEPKGYYANFCSGPCPYLRS---SDTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYV 392

  Fly   568 DQSTVVLKNYQEMTVVGCGC 587
            .: |..::....|.|..|.|
  Rat   393 GR-TPKVEQLSNMVVKSCKC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 47/228 (21%)
TGFB 487..588 CDD:214556 36/102 (35%)
Tgfb3NP_037306.1 TGFb_propeptide 24..230 CDD:395559 49/219 (22%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 1/1 (100%)
TGF_beta_TGFB3 312..412 CDD:381656 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.