DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Bmp3

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_058801.1 Gene:Bmp3 / 25667 RGDID:2212 Length:468 Species:Rattus norvegicus


Alignment Length:574 Identity:129/574 - (22%)
Similarity:199/574 - (34%) Gaps:207/574 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGSGRS-GSRSVGASTSTALAKAFNPFSEPASFSDSDKSHRSKTNKKPSKSDANRQFNEVHKPRT 112
            |||.|: .:|:.|:..         |..:|....::.:|.|       :.:....|...:|....
  Rat    68 SGSNRAQATRTPGSQL---------PGPQPLRGGNTVRSFR-------AAAAGTLQRKGLHTFNL 116

  Fly   113 DQLENSKN-KSKQL-----------VNKPNHNKMAVKEQRSHHKKSHHHRSHQPKQASASTESHQ 165
            ..|..|:| .|..|           ||.|.....:...||.|         .|...::.:.:|:|
  Rat   117 TSLTKSENILSATLYFYIGELVNTSVNCPESQGCSHDSQRQH---------IQIDLSAWTLQSNQ 172

  Fly   166 SSSIESIFVEEPTLVLDREVASINVPANAKAIIAEQGPSTYSKEALIKD------KLKPDPSTLV 224
            |..:..:.|:                 .||       |...|...|.||      |.|.|...|:
  Rat   173 SQLLGHLSVD-----------------TAK-------PYRDSMSWLSKDITQLLRKAKQDEEFLI 213

  Fly   225 EIEKSLLSLFNM-KRPPKIDRSKIIIPEPMKKLYAEIMGHELDSVNIPKPGLLTKSANTVRSFTH 288
            .        ||: .|..::.:..::.|||...:||       :...|.:|..:..|....|.|| 
  Rat   214 G--------FNITSRAHELPKRMLLFPEPYILVYA-------NDAAICEPESVVSSLQRHRDFT- 262

  Fly   289 KDSKIDDRFPHHHRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTRYQVLV--- 350
              :....|...|                         .|:|||.:....||:.      :|:   
  Rat   263 --AGTVPRLDSH-------------------------VREALSVERRKKRSTG------ILLPLQ 294

  Fly   351 --------YDITRVGVRGQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRNYGLLVEV 407
                    |.....||..:|:|                ..||..||        |:::       
  Rat   295 NNELPGAEYQYKEAGVWEERKP----------------YKSLQTQP--------PEKS------- 328

  Fly   408 RTVRSLKPAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRHKARSIRDVSGGEGGGKGGRNKR 472
            |:.:..:..||                |..|.|.|                  .|...|..|.|:
  Rat   329 RSKKKQRKGPH----------------QKGQTLQF------------------DEQTLKKARRKQ 359

  Fly   473 --QPRRPTRRKNHDDTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAV 535
              :||          .|.|..|.|||:|:||.:||::|..:|||||.|.|.||:......:|||.
  Rat   360 WIEPR----------NCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHAT 414

  Fly   536 VQTLVNNMN-PGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGCR 588
            :|::|..:. ...:|:.||||.::.|:::|:.::...||||.|..|||..|.||
  Rat   415 IQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 40/230 (17%)
TGFB 487..588 CDD:214556 42/101 (42%)
Bmp3NP_058801.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..53
TGFb_propeptide 46..>203 CDD:279078 35/183 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..93 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..349 13/97 (13%)
TGF_beta 364..467 CDD:278448 43/112 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.