DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and unc-129

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_501566.1 Gene:unc-129 / 177719 WormBaseID:WBGene00006852 Length:407 Species:Caenorhabditis elegans


Alignment Length:433 Identity:100/433 - (23%)
Similarity:158/433 - (36%) Gaps:110/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LLSLFNMKRPPKID-------------------------RSKIIIPEPMKKLYAEIMGHELDSVN 269
            |||:|::....|:|                         ||...:.|.||.||...:..:.:   
 Worm     9 LLSVFSIANCAKVDVDLINETIRDLLHFKSSDPNVTSFHRSSHTLTEHMKNLYENFIDEDSN--- 70

  Fly   270 IPKPGLLTKSANTVRSFTHKDSKIDDRFPHHHRFRLHFDVKSIPADEKLKAAELQL---TRDAL- 330
                    :..|.||:......|.:.:..      |.|||:...:.|.:..|||..   .||:. 
 Worm    71 --------EDGNLVRAIEPAVGKFEGQEV------LVFDVEGFDSHESIMRAELHFYLRRRDSFA 121

  Fly   331 ---SQQVVASRSSANRTRYQVLVYDITRVGVRGQREPSYLLLD-TKTVRLNSTDTVSLDVQPAVD 391
               |:|:.|.....|....|..:..| |||.....|...::.| ||:|    .|:..||.:.||.
 Worm   122 RRRSRQIRAKSVCVNEYCRQQTLKKI-RVGGDENLEEYKVIWDATKSV----FDSYHLDAKQAVF 181

  Fly   392 RWLA--SPQRNYGLLVE---------------VRTVRSLKPAPHHHVRLRRSA--DEAHERWQHK 437
            |...  |..|.|..::.               :.||..:|.. ....|.||..  :|..|.:.:.
 Worm   182 RITREHSKMRPYAEMIRKSTPFLVIYSKVNHTLDTVSVMKQT-EQTKRKRRDLGNEELREYYNYN 245

  Fly   438 Q-PLLFTYTDDGRH-------KARSIRDVSGGEG--GGKGGRNKRQPRRPTRRKNHD-------- 484
            . ||    .:|.|.       |..|:.:....|.  .|.|....|:.|.  |..|.:        
 Worm   246 SIPL----DNDDREPIKRKNGKKNSLSEEISSEDVWQGFGEETSREERE--RIANEELANDVRVV 304

  Fly   485 -----DTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMN 544
                 :.|.:..:.|.....|||.:::.|...:..:|.|||..|:.....::|||::|:|.    
 Worm   305 LLQNKNRCHKEGVLVSLKHFGWDRYVIEPKTIETSFCKGKCAKPMLTSGKASNHAMLQSLF---- 365

  Fly   545 PGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGC 587
              .....||.||.|.|:...|.:::...|::||.:|.:..|.|
 Worm   366 --AAEPVCCAPTNLKSLNFWYRDEKGRTVIRNYSKMLIGSCSC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 60/266 (23%)
TGFB 487..588 CDD:214556 29/101 (29%)
unc-129NP_501566.1 TGFB 312..406 CDD:214556 28/99 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.