DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and Bmp3

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001297606.1 Gene:Bmp3 / 110075 MGIID:88179 Length:470 Species:Mus musculus


Alignment Length:367 Identity:78/367 - (21%)
Similarity:128/367 - (34%) Gaps:93/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LTKSAN----TVRSFTHKDSKIDDRFPH-----HHRFRLHFDVKSIPADEK---LKAAELQLT-- 326
            ||||.|    |:..:..:...|....|.     ||..|.|..:     |..   ||:.:.||.  
Mouse   119 LTKSENILSATLYFYVGELVNISLSCPEPQGCSHHTQRQHIQI-----DLSAWILKSNQSQLLGH 178

  Fly   327 ---------RDA---LSQQVVASRSSANRTRYQVLVYDITRVGVRGQREPS--------YLLLDT 371
                     ||:   ||:.:......|.:....::.::||.   |....|.        |:|:..
Mouse   179 LSVDVVRPYRDSVSWLSKDITQLLRKAKQNEEFLIGFNITS---RAHELPKRMLFFPEPYILVYA 240

  Fly   372 KTVRLNSTDTVSLDVQ----------PAVDRWLASPQRNYGLLVEVRTVRS---LKPAPHHHVRL 423
            ....::..::|...:|          |.:|..:..     .|.||.|..||   |.|..::.:..
Mouse   241 NDAAISEPESVVSSLQRHRDFTAGTGPRLDSHVRE-----ALSVERRKKRSTGILLPLQNNELPG 300

  Fly   424 RRSADEAHERWQHKQPLLFTYTDDGRHKARSIRDVSGGEGGGKGGRNKRQPRRPTRRKN--HDDT 486
            .....:....|:.::|.....|..........:...|....|:..:...|..:..|||.  ....
Mouse   301 AEYQYKEEGAWEERKPYKSLQTQPPEKSRNKKKQRKGSHQKGQTLQFDEQTLKKARRKQWVEPRN 365

  Fly   487 CRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMNPGKVPKA 551
            |.|..|.|||:|:||.:||::|..:||:||.|.|.||:                        ||.
Mouse   366 CARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPM------------------------PKV 406

  Fly   552 CCVPTQLDSVAMLYLNDQ-------STVVLKNYQEMTVVGCG 586
            ......|..|.:.:|:..       .|:..:::.|.:..|.|
Mouse   407 AAAAAALHLVLISFLHGVEEYAKFFETIKSRHHPEHSASGGG 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 42/214 (20%)
TGFB 487..588 CDD:214556 29/107 (27%)
Bmp3NP_001297606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..349 4/34 (12%)
TGF_beta 364..>424 CDD:278448 25/83 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.