DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and wdr88

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_004913613.1 Gene:wdr88 / 101732918 XenbaseID:XB-GENE-6044415 Length:397 Species:Xenopus tropicalis


Alignment Length:152 Identity:36/152 - (23%)
Similarity:58/152 - (38%) Gaps:38/152 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 QRSHHKKSHHHRSHQPKQASASTESHQSSSIES-----------IFVEEPTLVL---DREVASIN 189
            |..|.:....|::|: ...|:.|.|...|.|.|           :......|||   :..|..::
 Frog   246 QFRHQRPDVLHKAHK-GSVSSCTFSKDMSVIVSGGYDKTVVLWDVIAASKKLVLKGHEDWVLDVS 309

  Fly   190 VPANAKAIIAEQGPST--------YSKEALIKDKLKPDPSTLVEIE--KSLLSLFNMKRPPKIDR 244
            :.||.|.|::....||        |.|...:.:.::...||:|:.|  |...|..|...|..:.|
 Frog   310 LSANKKWIVSSSKDSTLRLWNIENYEKIPAVTENIRALGSTVVQCEECKKPFSFMNWDNPDLLKR 374

  Fly   245 ---------SKII----IPEPM 253
                     |:|.    ||:|:
 Frog   375 CVFCRLATPSRICPLPPIPDPV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 11/44 (25%)
TGFB 487..588 CDD:214556
wdr88XP_004913613.1 WD40 34..330 CDD:238121 20/84 (24%)
WD40 repeat 47..83 CDD:293791
WD40 repeat 89..127 CDD:293791
WD40 repeat 129..166 CDD:293791
WD40 repeat 174..209 CDD:293791
WD40 repeat 216..254 CDD:293791 2/7 (29%)
WD40 repeat 263..289 CDD:293791 6/25 (24%)
WD40 repeat 305..329 CDD:293791 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.