DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and admp2

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_002939791.2 Gene:admp2 / 100494614 XenbaseID:XB-GENE-483127 Length:432 Species:Xenopus tropicalis


Alignment Length:411 Identity:104/411 - (25%)
Similarity:166/411 - (40%) Gaps:123/411 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LSLFNMKRPPKIDRSKIIIPEPMKKLYAEIMGHELDSVNIPKPGLLTKSANTVRSFTHKDSKIDD 295
            |::...|:||:.          |.:||:.:...:   .:...||||  ..|.||||.:|      
 Frog    90 LNILPEKKPPQF----------MLELYSRVASPD---GSTKAPGLL--QGNIVRSFENK------ 133

  Fly   296 RFPHHHRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTRY-QVLVYDITRVGVR 359
            .:.........|::.|:.:.||:..|||::.:....:.|       .|..: :|.||::.....|
 Frog   134 AYSESGEPLFFFNISSMGSREKMLKAELRVFKWKPLRIV-------PRHHFCKVDVYELIDSATR 191

  Fly   360 GQREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRNYGLLV----------EVRTVRSLK 414
            ..|..   |:.::.:.|........:|...|.:|:...:.|:|.||          ||..:...:
 Frog   192 PWRGN---LISSRLLPLQYQGWEMFNVTQTVSKWIGDNKTNHGFLVMFTLTSGNFLEVDLLAFTR 253

  Fly   415 PAPHHHVRLRRSADEAHERWQHKQPLLFTYTDDGRH----------------------------- 450
            ..|                 ..|:..|..::||||.                             
 Frog   254 HQP-----------------DSKRSYLVLFSDDGRRGTPNSFTSSQNMNDAGFLLPSSEDSSVFL 301

  Fly   451 -------------KARSIRDVSGGEGGGKGGRNKRQPRRPTRRKNHDDTCRRHSLYVDFSDVGWD 502
                         |:|.||:..          .::||           .|:|..|||||.::||.
 Frog   302 PTPHKFPLVVELSKSRKIREAF----------IEKQP-----------LCQRRPLYVDFEEIGWT 345

  Fly   503 DWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLVNNMNPGK-VPKACCVPTQLDSVAMLYL 566
            .||::|.||:||:|.|.|.|||.....:||||.||::|:.:...| :...||||.:|:|:.:||.
 Frog   346 GWIISPKGYNAYHCKGTCLFPLGQGLGATNHATVQSIVHALKLNKDIGTPCCVPDELNSINLLYF 410

  Fly   567 NDQSTVVLKNYQEMTVVGCGC 587
            :|:..||||.|.:|..|.|||
 Frog   411 DDEENVVLKQYNDMIAVSCGC 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 45/223 (20%)
TGFB 487..588 CDD:214556 49/102 (48%)
admp2XP_002939791.2 TGFb_propeptide 94..266 CDD:366248 44/219 (20%)
TGF_beta_ADMP 330..432 CDD:381643 49/102 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.