DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpp and espn

DIOPT Version :9

Sequence 1:NP_477311.1 Gene:dpp / 33432 FlyBaseID:FBgn0000490 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_012822811.2 Gene:espn / 100379704 XenbaseID:XB-GENE-960582 Length:1343 Species:Xenopus tropicalis


Alignment Length:215 Identity:47/215 - (21%)
Similarity:76/215 - (35%) Gaps:73/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GASTSTALAKAFN---------PFSE--PASFSDSDKSHRSKT-NKKPSKSDANRQFNEVHKPRT 112
            |..||....:|.|         |.||  |.....:|...||:. ||:||..|   .:..:.:..|
 Frog   466 GQHTSEIYVQAKNNLRHVDNELPSSENSPEGLRRADSCRRSRNFNKQPSTGD---YYKYIEQSTT 527

  Fly   113 DQLENSKNKSKQLVNKPNHNKMAVKEQRSHHKKSHHHRSHQPKQASASTESHQSSSI-------- 169
               |.|.:::.|:      .|||                |..:.:..|:|:.|:.:|        
 Frog   528 ---EKSTSETSQV------KKMA----------------HSEEGSVKSSETVQNGNISGNVPPPP 567

  Fly   170 ------ESIFVEEPTLVLDREVA---------SINVPANAKAIIAEQGPSTYSKEALIKDK---- 215
                  |::....|...|..|.:         |.|...:.|: .....|:..:.|.|.:.|    
 Frog   568 LPPPLPENLCFPPPPPPLPTESSIICSSSQRRSSNSTGSTKS-FNMMSPTGDNSELLAEIKAGKS 631

  Fly   216 LKPDPSTLVEIEKSLLSLFN 235
            |||.|.:     |.|.::|:
 Frog   632 LKPTPQS-----KGLTTVFS 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dppNP_477311.1 TGFb_propeptide 225..444 CDD:279078 3/11 (27%)
TGFB 487..588 CDD:214556
espnXP_012822811.2 Ank_2 6..101 CDD:403870
ANK repeat 6..33 CDD:293786
ANK repeat 35..67 CDD:293786
ANK repeat 69..101 CDD:293786
ANK repeat 103..127 CDD:293786
Ank_2 108..202 CDD:403870
ANK repeat 138..169 CDD:293786
ANK repeat 171..203 CDD:293786
Ank_2 176..270 CDD:403870
ANK repeat 205..269 CDD:293786
Ank_2 244..324 CDD:403870
ANK repeat 271..302 CDD:293786
WH2 615..640 CDD:396675 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.