DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9886 and glyctk

DIOPT Version :9

Sequence 1:NP_001259941.1 Gene:CG9886 / 33431 FlyBaseID:FBgn0031428 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001072628.1 Gene:glyctk / 780084 XenbaseID:XB-GENE-987121 Length:150 Species:Xenopus tropicalis


Alignment Length:167 Identity:68/167 - (40%)
Similarity:94/167 - (56%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRQTWEQMRQIFVQAVNAVHPEKVFADFQKFDLRPQIGENATDISIKLNGERQ--DISGK--- 60
            |...||  ..:|||.:||:||.|..:            :|.|   :::|.||:..  ...||   
 Frog     1 MMSLQT--DAKQIFWKAVSAVLPPNM------------LGRN---VAVKDNGDASVLQCGGKELP 48

  Fly    61 ---TCHIVGFGKAVLGMANKVQQDLGATSAGGVLSVP---VNTLKQF---QQPVAPG--LVVHEG 114
               ..::|||||||||||..|::.:|.....||:|:|   ..||||.   :..::|.  :.|.||
 Frog    49 LHNNLYLVGFGKAVLGMAAAVEKIVGKHLLRGVISIPRGMEETLKQAGKREMLLSPDSRIRVMEG 113

  Fly   115 AANNLPDENALKAAREIKQLAEKMTAQDILFVFISGG 151
            |.:|:||:.||:|||||:.||||:|.||||.|.||||
 Frog   114 AEHNMPDKAALEAAREIQSLAEKLTEQDILLVLISGG 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9886NP_001259941.1 DUF4147 10..261 CDD:290386 65/158 (41%)
GckA 12..487 CDD:225254 65/156 (42%)
MOFRL 367..480 CDD:282951
glyctkNP_001072628.1 DUF4147 8..>150 CDD:330921 63/156 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4783
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H14738
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1371490at2759
OrthoFinder 1 1.000 - - FOG0006220
OrthoInspector 1 1.000 - - oto104006
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.