DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and Pnlip

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus


Alignment Length:311 Identity:92/311 - (29%)
Similarity:134/311 - (43%) Gaps:39/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGF---GGGRTLSPSPDLREAYFSVG 132
            :|.|||....:..:.| ..|.:.:..::|.....|:||||||   |....||   |:.:..|.|.
Mouse    54 RFLLYTNENPDNYQLI-TSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLS---DMCKNMFRVE 114

  Fly   133 EYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHIAGL 197
            ..|.|.||:... .....:|.....|.....::.||..| :...|...:::|.||:|:|:||||.
Mouse   115 SVNCICVDWKGG-SRTTYTQATQNVRVVGAEVALLVNVL-QSDLGYSLNNVHLIGHSLGSHIAGE 177

  Fly   198 VANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGIL------GQWHSSG 256
            ..   |...|.:||||.|||...::.|......||.|||.|||.:||.||.:      |...:.|
Mouse   178 AG---KRTFGAIGRITGLDPAEPYFQGTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVG 239

  Fly   257 HADFYVNGGTRQPACVGSATLFQTL-------------ACDHTKVTPYFIESITTTRGFYAGPCP 308
            |.||:.|||...|.|..: .|.|.:             ||:|.:...::.:||....||....|.
Mouse   240 HLDFFPNGGIEMPGCQKN-ILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGFSCS 303

  Fly   309 NLFSYLIGWCEPKDSEYVLMGEHCSHKARG-------NYYVTTNAKAPFAR 352
            :...:....|.|..|.......|.:.:..|       .:|:.|..|:.|||
Mouse   304 SYSLFTANKCFPCGSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKSNFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 88/303 (29%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 89/307 (29%)
Pancreat_lipase_like 51..348 CDD:238363 88/303 (29%)
PLAT_PL 355..465 CDD:238857 92/311 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.