DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG34448

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster


Alignment Length:326 Identity:112/326 - (34%)
Similarity:171/326 - (52%) Gaps:26/326 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VAAAVAAGQNQTQVYVTDSCLQKPYRCPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRH 103
            :.:....|:|.|:.::.:.|:....:||:.::.|:|||.:|::.|..:|.|:|..   ..|.||.
  Fly    13 IVSGFCKGENHTRGWLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPIQLDPLNPQK---DVFQPRL 74

  Fly   104 PTKIIIHGFGGGRTLSPSPDLREAYFSVGEYNIIIVDYADAVKEPCLSQMDWAPR---FGSLCIS 165
            |.||:||||.|.|.|:|:.::|:........|:|.|||...|:.||  ...||..   ..|.|::
  Fly    75 PLKILIHGFIGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPC--YYPWAVNNAPIVSECLA 137

  Fly   166 QLVKYLARHPRGV-QPDDLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPT-IFFYAGANNS 228
            |::..|.  ..|: :.:|:|.||:|:||.:||:||||:..   .|.|||.|||. ..|....:..
  Fly   138 QMINNLI--SAGISRREDIHLIGFSLGAQVAGMVANYVSQ---PLARITGLDPAGPGFMMQPSLQ 197

  Fly   229 RDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVN-GGTRQPACVGSATLFQTLACDHTKVTPYF 292
            :.||::||.|||::||...........||||||.| ....|..| ...:.::...|:|.:...|:
  Fly   198 QKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGC-SYISNWRFYNCNHYRAAVYY 261

  Fly   293 IESITTTRGFYAGPCPNLFSYLIGWCEPKDSEY-----VLMGEHCSHKARGNYYVTTNAKAPFAR 352
            .|||.:.|||:|..|...|.:....|    |.|     ..||...|..|.|:|::||:..||||:
  Fly   262 GESIISERGFWAQQCGGWFDFFSQRC----SHYSNMPNTQMGYFVSEDASGSYFLTTHEVAPFAK 322

  Fly   353 G 353
            |
  Fly   323 G 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 101/288 (35%)
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 101/286 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.