DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and pnliprp2

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis


Alignment Length:343 Identity:97/343 - (28%)
Similarity:139/343 - (40%) Gaps:75/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LQKPY-RCP----HPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGF---GGG 115
            :|:|. |.|    |...:|.|:|:...:..:.|..|.|.|:..::|.....|:.|||||   |..
 Frog    38 VQRPIARLPDSPEHINTRFLLFTKENPDTFQEIRALTPGAISTSNFKASRKTRFIIHGFIEHGYD 102

  Fly   116 RTLSPSPDLREAYFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQP 180
            |.|:   .:......|.:.|...||:.... ....||.....|.....::..:::|: :..|...
 Frog   103 RWLT---HMCATLLKVEDVNCFCVDWTGGA-YALYSQAANNVRVVGAEVAHFIQFLS-NQYGYSA 162

  Fly   181 DDLHFIGYSVGAHIAGLVANYLKPEEGK----LGRITALDPTIFFYAGANNSRDLDSTDAHFVDV 241
            .::|.||:|:|:|.||        |.||    :.|||.|||...|:........||.:||..|||
 Frog   163 ANVHVIGHSLGSHAAG--------ETGKRTPGIARITGLDPAGPFFQNTPPEVRLDQSDAQLVDV 219

  Fly   242 LHTGAGIL------GQWHSSGHADFYVNGGTRQPACVGSATL------------FQTLACDHTKV 288
            :||.|..:      |...|.||.|||.|||...|.|..|.||            .:.:.|.|.:.
 Frog   220 IHTDASAIFPLTGFGIGQSVGHLDFYPNGGKNMPGCKKSPTLKYLDNYRIFKGSKEIIFCSHIRS 284

  Fly   289 TPYFIESITTTRGFYA--------------GPCPNLFSYLIGWCEPKDSEYVLMGEHCSH---KA 336
            ..::.|||.|...|.|              .|||:      |.|.       |||.:...   ..
 Frog   285 YKFYTESILTPDAFVAFPSSDYKTFKKGTGFPCPS------GGCP-------LMGHYAEEFLGPT 336

  Fly   337 RGN--YYVTTNAKAPFAR 352
            .||  :::.|....||||
 Frog   337 SGNLSFFLNTGNSEPFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 88/321 (27%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 93/339 (27%)
PLAT 355..466 CDD:320707 97/343 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.