DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and lipia

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:304 Identity:85/304 - (27%)
Similarity:135/304 - (44%) Gaps:34/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLR---EAYFS 130
            |::..||||......:.:...:|  ...:.||....|..:|||:  ..|.||...::   |...:
Zfish    44 KVRLLLYTRADPSCGQLLSHQEP--FSNSQFNVSSVTTFLIHGY--RPTGSPPVWMKQFVEFLLN 104

  Fly   131 VGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHIA 195
            ..:.|:|:||:..........|:....|..:..::.|::.:  ...|.....:|.||.|:||||:
Zfish   105 RRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQKM--KDNGANLSSIHMIGVSLGAHIS 167

  Fly   196 GLV-ANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHAD 259
            |.. ||:    .|::||||||||....:.|......||.:||.||:.|||....||..:..||.|
Zfish   168 GFTGANF----NGEIGRITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDMDALGYRNLLGHID 228

  Fly   260 FYVNGGTRQPAC----VGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWC-- 318
            :|.|||..||.|    :..:..|:   |||.:....::.|:..:....|.||.:...:..|.|  
Zfish   229 YYANGGADQPGCPKTILSGSEYFK---CDHQRSVFLYMSSVNGSCPIIAYPCESYTDFQDGTCMD 290

  Fly   319 --EPKDSEYVLMGEHCSHKARGNY--------YVTTNAKAPFAR 352
              :.|.:...:.| :.|.:.|...        |..||..:||.:
Zfish   291 CGKFKSAGCPIFG-YDSVRWRDTLVQLEQTRTYFQTNKASPFCK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 82/296 (28%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 82/296 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.