DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG6277

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:286 Identity:87/286 - (30%)
Similarity:146/286 - (51%) Gaps:21/286 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 IQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYFSVGEY 134
            ::|||||.....:.:.| .....::..:.||..|||:.:|||:....|.|.:.|:|.|:.|.|:|
  Fly    68 VKFYLYTSSNPTKGKKI-TASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGDY 131

  Fly   135 NIIIVDYADAVKEPCLSQMDWAPRFGSLC-----ISQLVKYLARHPRGVQPDDLHFIGYSVGAHI 194
            |:|:||:|.|      ..:|:|....::.     :::::.:| :...|:..:||:.||:|:|||:
  Fly   132 NVIVVDWARA------RSVDYATSVLAVAATGKKVAKMINFL-KDNHGLNLNDLYVIGHSLGAHV 189

  Fly   195 AGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHAD 259
            ||...   |..:|::..|..|||.:..::....::.|:|.||.:|:.:.|..|.||.....|...
  Fly   190 AGYAG---KNTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGA 251

  Fly   260 FYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPKDSE 324
            ||.|||..||.|    .|..|.||.|.:.|.|:.|:::.. .|....|.:....:...|....|.
  Fly   252 FYPNGGKTQPGC----GLDLTGACSHGRSTTYYAEAVSED-NFGTMKCGDYEEAVSKECGSTYSS 311

  Fly   325 YVLMGEHCSHKARGNYYVTTNAKAPF 350
            ..:..:..::...|:|||..|:||||
  Fly   312 VRMGADTNAYMVEGDYYVPVNSKAPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 82/280 (29%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 82/280 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.