DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG6283

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster


Alignment Length:290 Identity:88/290 - (30%)
Similarity:142/290 - (48%) Gaps:24/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 IQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLR----EAYFS 130
            :.||:||:......:.|.. ...::..:|||..|.|:.:|||:    |...|.|:.    :|:.|
  Fly    65 VNFYVYTKSNPTDGKEIKA-KSGSVEDSHFNKDHGTRFVIHGW----TQRYSDDMNTRITKAWLS 124

  Fly   131 VGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHIA 195
            .|:||:|:||:|.|......|.:...|..|.. :.:::|||..| .|:..|.|..||:|:|||:|
  Fly   125 KGDYNVIVVDWARARSVDYASSVLAVPGAGGK-VGEMIKYLHDH-HGLDYDSLEVIGHSLGAHVA 187

  Fly   196 GLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHADF 260
            |.....:  .:.::..|..|||.:..::....::.|.:.|||:|:.:.|..|.||.....|...|
  Fly   188 GYAGKTV--GDKRVHTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAF 250

  Fly   261 YVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPKDSEY 325
            |.|||..||.|    .|..|.:|.|.:...|:.|::|.. .|.:..|.:....:...|   .|.|
  Fly   251 YPNGGKSQPGC----GLDATGSCSHARSVLYYAEAVTED-NFGSIKCHDYEDAVAKNC---GSTY 307

  Fly   326 --VLMGEHC-SHKARGNYYVTTNAKAPFAR 352
              |.||... ::...|::||..|::|||.:
  Fly   308 SSVRMGAITNAYMVEGDFYVPVNSEAPFGK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 84/282 (30%)
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 84/282 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.