DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and sxe2

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:375 Identity:104/375 - (27%)
Similarity:169/375 - (45%) Gaps:48/375 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WLQLLCVSFTLFHLEFAAAQNAGVVAAAVAAGQNQTQVYVTD-----------SCLQKPYRCPHP 68
            ||...|:.     |..||..:|.|...|.|.|  :.:|.::|           ..|.:|......
  Fly    12 WLLWTCLL-----LLGAAGTDASVDYFAYAPG--KCEVSISDVIQGMITTEAGVILGRPRPSQTK 69

  Fly    69 KIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYFSVGE 133
            .:::.|||....|:.:.:...|...|..:||||:.|.::.|||:.|......:..:::||.|.|.
  Fly    70 LLRYDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGN 134

  Fly   134 YNIIIVDYADA---VKEPCLSQMDWAPRFGSLCISQLVKYLARHPR-GVQPDDLHFIGYSVGAHI 194
            ||:||:|::..   :..|.:|:.  .|...: .:::::::|  |.. ||..:.::.||:|.|:||
  Fly   135 YNVIILDWSRQSLDISYPRVSKQ--LPSIAA-NVAKMLRFL--HDNTGVPYEQIYMIGHSAGSHI 194

  Fly   195 AGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSS-GHA 258
            :||....|:|.  :||.|.||||.............||..||.:|:.:||...:||...:. .||
  Fly   195 SGLTGKLLRPH--RLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKLSHA 257

  Fly   259 DFYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPK-- 321
            .|:.|.|..||.|..:........|||.....||.||:...:.|.|..|.:..|.|...|...  
  Fly   258 SFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSAKSVLSATCNCNVG 322

  Fly   322 -DSEYVL--------MGEHCSHKARGNYYVTTNAKAPFARGFPGKGRSNG 362
             ..:|.:        ||...:...||.:|::|..::|:       |.|:|
  Fly   323 GSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPY-------GTSDG 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 85/293 (29%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 87/313 (28%)
Pancreat_lipase_like 72..356 CDD:238363 85/290 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.