DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG5665

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster


Alignment Length:318 Identity:86/318 - (27%)
Similarity:129/318 - (40%) Gaps:54/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PKIQFYLYTRRTQEQPEFIDVLDPNALY-YTHFNPRHPTKIIIHGFGGGRTLSPSPD---LREAY 128
            |.|:...:...|..|...:.:|:.:.|: ::.|:...  |::|...|...|::.|..   :.:|:
  Fly    81 PDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGR--KVVILATGWTNTVNESSAISMISKAF 143

  Fly   129 FSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQP-DDLH-------- 184
            ...|:.|.:|||.||.|.    :...|:.....| |.:.:.....|...:.| .::|        
  Fly   144 MCRGDVNFVIVDAADYVD----TFYAWSALNTDL-IGEHIGVGLTHLIELTPLRNIHLIGGFIKE 203

  Fly   185 -----------FIGYSVGAHIAGLVANYLKPEEGKL-GRITALDPTIFFYAGANNSRDLDSTDAH 237
                       |:|:|:||||.|......|...||| .|||.|||....:........|...||.
  Fly   204 SFVSINSGSDFFVGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAK 268

  Fly   238 FVDVLHTGAGILGQWHSSGHADFYVNGG-TRQPACVGSATLFQTLACDHTKVTPYFIESI--TTT 299
            .||::||..|||.:....|..|||..|. ..||.|:       |:.|.||:...||.||.  ...
  Fly   269 LVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGCL-------TIGCSHTRAVEYFAESAYPHQE 326

  Fly   300 RGFYAGPCPNLFSYLIGWCEPKDSEYVL-----MGEHCSHKARGNYYVTTNAKAPFAR 352
            :.|....|.:       |.|.:..:...     ||...:.:|||.|||..|...|:.|
  Fly   327 KNFMGKKCAS-------WDELRKRDCSAGIVSPMGYRMNPQARGIYYVDVNGWPPYGR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 83/310 (27%)
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 81/305 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.