DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and LIPC

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:330 Identity:87/330 - (26%)
Similarity:134/330 - (40%) Gaps:77/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTL-------------SP 120
            |.:|.|:....|...  |.:..|:.|....||...|..:||||:.....|             .|
Human    61 KTRFLLFGETNQGCQ--IRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQP 123

  Fly   121 SPDLREAYFSVGEYNIIIVD--------YADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRG 177
            :..:          |:.:||        |..||:...|...:         ::.|:::|....: 
Human   124 AQPV----------NVGLVDWITLAHDHYTIAVRNTRLVGKE---------VAALLRWLEESVQ- 168

  Fly   178 VQPDDLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVL 242
            :....:|.||||:|||::|...:.:.... |:||||.||.....:.|:..|..|...||:|||.:
Human   169 LSRSHVHLIGYSLGAHVSGFAGSSIGGTH-KIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAI 232

  Fly   243 HT------GAGILGQWHSSGHADFYVNGGTRQPAC-----------VGSATLFQTLACDHTKVTP 290
            ||      |..: |.....||.|||.|||:.||.|           .|...:.||:.|.|.:...
Human   233 HTFTREHMGLSV-GIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVH 296

  Fly   291 YFIESITTTRGFYAG------PCPNLFSYLIGWC-EPKDSEYVLMGEHCSHKARG---NYYVTTN 345
            .||:|:     .:||      ||.::.|:..|.| ..|......:|.|...:.|.   ..::.|.
Human   297 LFIDSL-----LHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTR 356

  Fly   346 AKAPF 350
            |::||
Human   357 AQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 84/324 (26%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.