DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG10116

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:286 Identity:86/286 - (30%)
Similarity:132/286 - (46%) Gaps:31/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYFSVGEYNI 136
            |:|.|||.||..:.|:. :..||..:.|....||.:.|..:.|..:....|.:..|.....:.||
  Fly    24 FFLNTRRVQENAQPIEA-EVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNI 87

  Fly   137 IIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQP-DDLHFIGYSVGAHIAGLVAN 200
            |.||.::|..|..:..          .::.||  :..|.:...| |.:..:|::.|||:||.||.
  Fly    88 ISVDLSEANDETEIID----------SVASLV--IVLHNQFDMPLDRILVVGFAEGAHLAGGVAA 140

  Fly   201 YLKPEEGK-LGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVNG 264
            .::.:.|: |.:||||||:    :||.....|...||.||:|:||.||..|.|...||.|:|.||
  Fly   141 KVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNG 201

  Fly   265 GTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPKDSEYVLMG 329
            |..||.|.       |.:|.|.:......|..:....|.:..|.::.:.....|.....:   ||
  Fly   202 GQTQPGCT-------TDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRWSTHK---MG 256

  Fly   330 EHCSHK--ARGNYYVTTNAKAPFARG 353
            :....:  |.|.|::.|...:||:||
  Fly   257 QKQEEEQPASGIYFLETRQSSPFSRG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 82/277 (30%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 81/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.