DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and lipca

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:264 Identity:80/264 - (30%)
Similarity:112/264 - (42%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PKIQFYLYT-RRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPD-LREAYF- 129
            ||..|.:|| ....|....:::..|:.|....||...|..|||||:        |.| :.|.:. 
Zfish    42 PKSVFRVYTDGEYTEDTCALELFQPHTLDACGFNSSLPLAIIIHGW--------SVDGMMEKWIS 98

  Fly   130 --------SVGEYNIIIVDYADAVKE--PCLSQMDWAPRFGSLCISQLVKYL---ARHPRGVQPD 181
                    |.|..|::|.|:.....:  |..:|   ..|.....|:.|:.:|   .:.|.|    
Zfish    99 RLASALKSSEGNINVLIADWLTLAHQHYPIAAQ---NTRIVGQDIAHLLSWLEDFKQFPLG---- 156

  Fly   182 DLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHT-- 244
            .:|.||||:||||:|...:.|......|||||.|||....:.|.:::..|...||.|||.:||  
Zfish   157 KVHLIGYSLGAHISGFAGSNLAMSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTFT 221

  Fly   245 ----GAGILGQWHSSGHADFYVNGGTRQPACV-------------GSATLFQTLACDHTKVTPYF 292
                |..: |......|.|||.|||:.||.|.             |.....||:.|.|.:....|
Zfish   222 LQRMGLSV-GIKQPVAHFDFYPNGGSFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLF 285

  Fly   293 IESI 296
            |:|:
Zfish   286 IDSL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 80/264 (30%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 78/262 (30%)
Pancreat_lipase_like 54..344 CDD:238363 75/252 (30%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.