DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG6675

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:298 Identity:95/298 - (31%)
Similarity:140/298 - (46%) Gaps:25/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PYRCPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLRE 126
            |:.....::.|||:.|...|....:|........:..||...||:::|||:......|.:.|::.
  Fly   110 PFGSKKLRMHFYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKN 174

  Fly   127 AYFSVGEYNIIIVDY-ADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSV 190
            ||...||||:|:||: |.:......|.:.....||:. ::|.::.|.|. .|...|.::.||:|:
  Fly   175 AYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAE-LAQFIRNLNRQ-FGADFDSMYLIGHSL 237

  Fly   191 GAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSS 255
            ||.|||.....|||.  |:..|.||||....:........:|.:||.:|:.:||.|. .|....:
  Fly   238 GAQIAGSAGKRLKPV--KVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSAN-FGFRRPT 299

  Fly   256 GHADFYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPC--PNLFSYLIG-W 317
            |.|.||.|.|..|.:|       ..|.|.|.:....|.|||.:..||:..||  .|      | |
  Fly   300 GSATFYPNYGAYQHSC-------YYLGCSHIRSYQMFAESINSPLGFWGTPCIRDN------GRW 351

  Fly   318 -CEPKDSEYVLM-GEHCSHKARGNYYVTTNAKAPFARG 353
             |:....:.:.| ||...|| .|.:||.|::..|||.|
  Fly   352 QCDYSQRQSIQMAGEPSIHK-EGIFYVKTSSSDPFALG 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 90/283 (32%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 90/283 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.