DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG13282

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:293 Identity:107/293 - (36%)
Similarity:157/293 - (53%) Gaps:14/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CPHPKIQFYLYTRRTQEQPEFIDV---LDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLRE 126
            ||.|.:::|:|||......:.:.:   |:.:.|..::||||:||||||||:.....|.|...:||
  Fly    72 CPDPDVKYYIYTRHNPMDRQCLHIDESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHPLQQMRE 136

  Fly   127 AYFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVG 191
            .|.:..:||||.||::.....||........:....|.:|||:.|..    ....|:|.||:|:|
  Fly   137 EYLAKADYNIIYVDWSILSPGPCYISAVHNTKHAGTCTAQLVERLVE----TGNTDIHVIGFSLG 197

  Fly   192 AHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSG 256
            |.:...:|..|  ....|.|||.|||.:..:..:..:..||.:||.:|||:||.|.:.|:....|
  Fly   198 AQVPNYIARNL--SSFMLPRITGLDPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCG 260

  Fly   257 HADFYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPK 321
            |||||:|||..||.|.|..  ..:.||.|.:...||:|||.:.:||:...|....|||:|.|.| 
  Fly   261 HADFYMNGGIMQPGCNGQK--INSFACSHQRAPAYFLESIRSPKGFWGWACSGYISYLLGMCPP- 322

  Fly   322 DSEYVL-MGEHCSHKARGNYYVTTNAKAPFARG 353
             :.::| .||:.....||.:.:.||..:|||.|
  Fly   323 -TNFLLEAGENIRPTTRGMFMIDTNDSSPFALG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 100/281 (36%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 103/288 (36%)
Pancreat_lipase_like 75..347 CDD:238363 100/281 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.