DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG6431

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:247 Identity:81/247 - (32%)
Similarity:118/247 - (47%) Gaps:11/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYF 129
            ||...|.:.|:|.....:...::|.:|..||...|:....|..|||||.|.........||:||.
  Fly    56 CPKRFIDYQLFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYL 120

  Fly   130 SVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHI 194
            | .::|:|.||:....:.||........|..:.|.:|:..:|..:  |...:.:..:|:|:||||
  Fly   121 S-RDFNVITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTHY--GAVRERITCVGHSLGAHI 182

  Fly   195 AGLVANYLKPEEGKLGRITALDPT--IFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGH 257
            .|:::|:|   ..|..||..|||.  :.....:|..| |...||:.:.||||.||.|||..:|||
  Fly   183 CGMISNHL---TRKQYRIIGLDPARPLIERMKSNKFR-LSIDDANVIQVLHTNAGFLGQEDNSGH 243

  Fly   258 ADFYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPN 309
            .::.||||..||.|.|:.  .:...|.|.....|...:......|...||||
  Fly   244 LNYCVNGGRIQPFCKGNP--IRKSRCSHFLSICYLATATFKHNKFMGVPCPN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 79/244 (32%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.