DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG14034

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:289 Identity:117/289 - (40%)
Similarity:160/289 - (55%) Gaps:10/289 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYF 129
            ||:..|.|:|||:..||..: :.|.:.|...:.|   ..|.|::||||.|.|..||:..|| ..|
  Fly    33 CPNANISFWLYTKENQEGTK-LSVFELNRFEFYH---HKPLKVLIHGFNGHRDFSPNTQLR-PLF 92

  Fly   130 SVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHI 194
            ...:||:|.:||.....|||.::.....::.:.|.:||::.|..... |:.:|||.||..:|||:
  Fly    93 LTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGL-VKIEDLHLIGLGLGAHV 156

  Fly   195 AGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHAD 259
            ||.:..:| ||. ||..||||||...||...:.:..||.|||.||||:||...:||...:.||.|
  Fly   157 AGFIGQFL-PEH-KLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVD 219

  Fly   260 FYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPKDSE 324
            ||:|.|..||.| |.....:|..|.|.:...|:.|||::..|||...|||..|:..|.|.| |..
  Fly   220 FYLNMGVSQPNC-GPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIP-DKN 282

  Fly   325 YVLMGEHCSHKARGNYYVTTNAKAPFARG 353
            ..|||.|...||||.|::.||...|:|:|
  Fly   283 IELMGFHVDPKARGRYFLDTNNGPPYAKG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 111/277 (40%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 110/275 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.