DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and CG6847

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster


Alignment Length:372 Identity:99/372 - (26%)
Similarity:151/372 - (40%) Gaps:102/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QFYLY-TRRTQEQP----EFIDVLDP---------------------------------NALYYT 97
            :||.| ||:..::|    .|:::.:.                                 ||..:|
  Fly   102 KFYFYSTRQRSDRPLMELSFLNMTNAFRGKRETEVSTSSPEGTSGRSSVASAPSSMSAVNATTFT 166

  Fly    98 HFNP----RHPT--------------KIIIHGFGGGRTLSPSP-----DLREAYFSVGEYNIIIV 139
            ...|    :.||              ::|:||||     |..|     :::.|..:|.:..:|.|
  Fly   167 TERPGGGQKKPTPSIDDLEGFDELSVRVIVHGFG-----SACPHVWIYEMKTALMAVEDCIVICV 226

  Fly   140 DYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHIAGLVANYLKP 204
            |:.:....|...:.....|.....::.|::.|.:| :|:.....|.||:|:|||::|    :...
  Fly   227 DWENGATFPNYVRAAANTRLVGKQLAMLLRNLQQH-KGLDLMRTHVIGFSLGAHVSG----FAGA 286

  Fly   205 EEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGA-----GILGQWHSSGHADFYVNG 264
            |...|.|||.|||....:...:....|||:||.||||:|:..     |.||.|...||.|:|.||
  Fly   287 ELPGLSRITGLDPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNG 351

  Fly   265 GTRQPAC----VGSATLFQTLA-----------CDHTKVTPYFIESITTTRGFYAGPCPNLFSYL 314
            |..|..|    ||:.|.|...|           |:|.:...:||:|:.....|.|.||.|...:|
  Fly   352 GRVQTGCSNLFVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFL 416

  Fly   315 IGWCEP--KDSEYVLMG-EHCSH--------KARGNYYVTTNAKAPF 350
            .|.|.|  :|.|.:..| ..|.:        ..||..|:.|..:.||
  Fly   417 KGRCFPCAQDDEDLAEGVPRCGNMGYYADRSTGRGQLYLLTREEEPF 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 97/366 (27%)
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 97/370 (26%)
Pancreat_lipase_like 185..459 CDD:238363 84/283 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.