DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and Yp3

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:198 Identity:64/198 - (32%)
Similarity:88/198 - (44%) Gaps:20/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 RGVQPDDLHFIGYSVGAHIAGLVANYLKPEEG-KLGRITALDPTIFFYAGANNSRDLDSTDAHFV 239
            :||..:.:|.||..:.||:||...|....:.| ||.|||.|||.............|...||.||
  Fly   232 KGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFV 296

  Fly   240 DVLHTGAGILGQWHSSGHADFYVNG-GTRQPACVGSATLFQTLACDHTKVTPYFIESIT--TTRG 301
            |.:||....:|.....|..|||.|| .|..|   ||..:.:.:|    :.|.||.||:.  :.|.
  Fly   297 DAIHTSTFAMGTPIRCGDVDFYPNGPSTGVP---GSENVIEAVA----RATRYFAESVRPGSERN 354

  Fly   302 FYAGPCPNLFSYLIGWCEPKD--SEYVLMGEHCSHKARGNYYVTTNAKAPFARGFPGKGRSNGEY 364
            |.|.|..:|..|     :.:|  .:...||....:..||:|.:..|||:||.:..|  ......|
  Fly   355 FPAVPANSLKQY-----KEQDGFGKRAYMGLQIDYDLRGDYILEVNAKSPFGQRSP--AHKQAAY 412

  Fly   365 QGV 367
            .|:
  Fly   413 HGM 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 56/175 (32%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 59/179 (33%)
Abhydrolase <215..396 CDD:304388 56/175 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.