DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and Yp1

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:345 Identity:92/345 - (26%)
Similarity:147/345 - (42%) Gaps:60/345 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GQNQTQVYV-----TDSCLQKPYRCPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPT 105
            |:::..:.|     |...::|..|   ..:|.|:.....|:|.:  ...:.|..|....|.:...
  Fly   122 GEDEVTIIVTGLPQTSETVKKATR---KLVQAYMQRYNLQQQRQ--HGKNGNQDYQDQSNEQRKN 181

  Fly   106 KIIIHGFGGGRTLSP---SPDLREAYFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCI--- 164
            :         ||.|.   |.:::.|....|:  ||::|..        |:::...|:..|.|   
  Fly   182 Q---------RTSSEEDYSEEVKNAKTQSGD--IIVIDLG--------SKLNTYERYAMLDIEKT 227

  Fly   165 -SQLVKYLAR--HPRGVQPDDLHFIGYSVGAHIAGLVANYLKPEEG-KLGRITALDPTIFFYAGA 225
             :::.|::.:  :...:..|.:|.||.:||||:||..|.......| ||.|:|.|||:.......
  Fly   228 GAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSK 292

  Fly   226 NNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVNGGTRQPAC--VGSATLFQTLACDHTKV 288
            |....|...||.|||.:||....:|....||..|||.||    ||.  .|::.:.:..    .:.
  Fly   293 NTLTGLARGDAEFVDAIHTSVYGMGTPIRSGDVDFYPNG----PAAGVPGASNVVEAA----MRA 349

  Fly   289 TPYFIESIT--TTRGFYAGPCPNLFSYLIGWCEPKD--SEYVLMGEHCSHKARGNYYVTTNAKAP 349
            |.||.||:.  ..|.|.|.|..:|..|     :..|  .:...||...:|...|:|.:..|.|:|
  Fly   350 TRYFAESVRPGNERSFPAVPANSLQQY-----KQNDGFGKRAYMGIDTAHDLEGDYILQVNPKSP 409

  Fly   350 FARGFPGKGRSNGEYQGVRR 369
            |.|..|.:.:|:  |.||.:
  Fly   410 FGRNAPAQKQSS--YHGVHQ 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 77/293 (26%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.