DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and Lipi

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:367 Identity:112/367 - (30%)
Similarity:157/367 - (42%) Gaps:76/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HLEFAAAQNAGVVAAAVAAGQNQTQVYVTDSCLQ----------KPYRCPHPKIQFYLYTRRTQE 81
            :|.|.:..|.|    :.....|:|       ||:          |....|..||...:|:|...:
  Rat    17 YLNFPSKSNGG----SKNPENNRT-------CLEFSKSNAMNSLKDLFYPTVKINLLMYSRNNAK 70

  Fly    82 QPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSP----DLREAYFSVGEYNIIIVD-- 140
            ..|  .:.:.|......|||...|..||||:   |.|..:|    ...:|:....:.|:|:||  
  Rat    71 CAE--PLFESNNSVNARFNPSKKTIWIIHGY---RPLGSTPMWIHKFTKAFLKQEDVNLIVVDWN 130

  Fly   141 -------YADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHIAGLV 198
                   |..|||.         .|..:..:.:.::.|..|  |...|:.||||.|:||||.|.|
  Rat   131 QGATTFIYGRAVKN---------TRKVAEILREYIENLLIH--GASLDNFHFIGMSLGAHICGFV 184

  Fly   199 ANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHT---GAGILGQWHSSGHADF 260
            .   |..:|:|||||.|||....::|..::..||.|||.||||:|:   |.|||   ..|||.||
  Rat   185 G---KLFQGQLGRITGLDPAGPKFSGKPSNCRLDYTDAKFVDVIHSDSQGFGIL---EPSGHIDF 243

  Fly   261 YVNGGTRQPACVGS-ATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEP---- 320
            |.|||..||.|..| .:....:.|||.:....|:|:..|...|.:.||.:...|..|.|..    
  Rat   244 YPNGGRNQPGCPTSLLSGMDYIKCDHQRAVHLFLEAFETNCNFVSFPCRSYRDYKSGLCVGCGNL 308

  Fly   321 -KDS------EYVLMGEHCSHKA-----RGNYYVTTNAKAPF 350
             |||      :..|..|....|.     |...::.|:::.||
  Rat   309 YKDSCPRLGIQANLWKEELKKKTEEWPLRTTAFLDTSSQNPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 100/310 (32%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 100/310 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.