DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and LIPH

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:329 Identity:91/329 - (27%)
Similarity:135/329 - (41%) Gaps:69/329 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IRADFWLQLLCV----------SFT--LFHLEFAAAQNAGVVAAAVAAGQNQTQVYVTDSCLQKP 62
            :|...::.|||:          |||  .||            :|.|..|.|              
Human     2 LRFYLFISLLCLSRSDAEETCPSFTRLSFH------------SAVVGTGLN-------------- 40

  Fly    63 YRCPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSP----D 123
                   ::..||||:.....:.|     |:..:.:.|....|..|:|||   |.....|    |
Human    41 -------VRLMLYTRKNLTCAQTI-----NSSAFGNLNVTKKTTFIVHGF---RPTGSPPVWMDD 90

  Fly   124 LREAYFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGY 188
            |.:...||.:.|:::||:.........:......|..::.:.:.:..:.  ..|...||::.||.
Human    91 LVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQML--AEGASLDDIYMIGV 153

  Fly   189 SVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWH 253
            |:||||:|.|....   :|.|||||.|||....:.|..:...||.:||.||||:|:....||...
Human   154 SLGAHISGFVGEMY---DGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDALGYKE 215

  Fly   254 SSGHADFYVNGGTRQPAC----VGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYL 314
            ..|:.|||.|||..||.|    :|.   ||...|||.:....::.|:..:....|.||.:...|.
Human   216 PLGNIDFYPNGGLDQPGCPKTILGG---FQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYR 277

  Fly   315 IGWC 318
            .|.|
Human   278 NGKC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 78/259 (30%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 79/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.