DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:322 Identity:85/322 - (26%)
Similarity:132/322 - (40%) Gaps:62/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGF-GGGRTLSPSPDLREAYFSVGEY 134
            :|.|||.......:.|..::.:.:..::|.....|:|.|.|: ..|:.   ..|:......:.:.
Human    55 RFLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKW---QRDMCNVLLQLEDI 116

  Fly   135 NIIIVDYADAVKE--PCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHIAGL 197
            |.|.:|:.:..:|  ..::.:.......:..|..|:|...     ..|..:|.||:|:|||:|| 
Human   117 NCINLDWINGSREYIHAVNNLRVVGAEVAYFIDVLMKKFE-----YSPSKVHLIGHSLGAHLAG- 175

  Fly   198 VANYLKPEEGK----LGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGIL------GQW 252
                   |.|.    |||||.|||...|:........||.:||:||||:||.|..:      |..
Human   176 -------EAGSRIPGLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTI 233

  Fly   253 HSSGHADFYVNGGTRQPACVGSAT-------------LFQTLACDHTKVTPYFIESITTTRGFYA 304
            .:.||.|||.|||...|.|....|             :.....|:|.:...::.|||.....|.|
Human   234 DACGHLDFYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIA 298

  Fly   305 GPCPNLFSYLIGWCEPKDSEYVLMGEHC-------------SHKARG-NYYVTTNAKAPFAR 352
            .||.:..|:..|.|      :....|.|             :.|..| :|::.|.:.:||||
Human   299 YPCRSYTSFKAGNC------FFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLSPFAR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 81/314 (26%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 81/318 (25%)
Pancreat_lipase_like 52..348 CDD:238363 81/314 (26%)
PLAT_PL 355..467 CDD:238857 85/322 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.