DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:330 Identity:92/330 - (27%)
Similarity:137/330 - (41%) Gaps:47/330 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LQKPYR----CPHP-KIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGF----GG 114
            ||:|.:    .|.. ..:|.|||.......:.|...:|:.:.:::|.....|:.|:|||    ..
  Rat    51 LQRPLKIFPWSPEDIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGED 115

  Fly   115 GRTLSPSPDLREAYFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQ 179
            |..|    |:.:..|.|.:.|.|.||:....:.. .:|..:..|.....|:.||:.|:.. .|..
  Rat   116 GWLL----DMCKKMFQVEKVNCICVDWRRGSRTE-YTQASYNTRVVGAEIAFLVQVLSTE-MGYS 174

  Fly   180 PDDLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHT 244
            |:::|.||:|:|||:.|.....|   ||.:||||.|||....:.|......||.:||.||||:||
  Rat   175 PENVHLIGHSLGAHVVGEAGRRL---EGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHT 236

  Fly   245 GAGIL------GQWHSSGHADFYVNGGTRQPACVGSATLFQTL--------------ACDHTKVT 289
            .:..:      |.....||.||:.|||...|.|  ...:..|:              ||:|.:..
  Rat   237 DSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGC--QKNILSTIVDINGIWEGTQNFVACNHLRSY 299

  Fly   290 PYFIESITTTRGFYAGPCPNLFSYLIGWCEPKDSEYVLMGEHCSHKARG-------NYYVTTNAK 347
            .|:..||....||...||.:...:....|.|...|......|.:.:..|       ..|:.|...
  Rat   300 KYYASSILNPDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFEGKTATVEQTVYLNTGDS 364

  Fly   348 APFAR 352
            ..|.|
  Rat   365 GNFTR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 86/309 (28%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 90/326 (28%)
Pancreat_lipase_like 65..363 CDD:238363 86/308 (28%)
PLAT_PL 370..482 CDD:238857 92/330 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.