DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18641 and LOC100331214

DIOPT Version :9

Sequence 1:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:261 Identity:74/261 - (28%)
Similarity:111/261 - (42%) Gaps:61/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YTRRTQEQPE----FIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREA-------- 127
            ::.|...||:    :|.......|...:||....|.::|||:    |:|   .|.|:        
Zfish    55 FSLRNPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGW----TVS---GLFESWVEKLVAA 112

  Fly   128 -YFSVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLAR----------HPRGVQPD 181
             |....:.|:|:||:.|..::            ..:..:|..|.:.|          ....|..:
Zfish   113 LYNREKDANVIVVDWLDTAQD------------HYVVAAQNTKMVGREIGLFIDWIEETSNVPLE 165

  Fly   182 DLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHT-- 244
            :||.||||:|||:||...::   ...|:||||.|||....:.|.:....|...||||||||||  
Zfish   166 NLHLIGYSLGAHVAGFAGSH---TTNKIGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFT 227

  Fly   245 --GAGI-LGQWHSSGHADFYVNGGTRQPAC-----------VGSATLFQTLACDHTKVTPYFIES 295
              ..|: :|.....||.|.|.|||:.||.|           .|...:...:.|:|.:....||:|
Zfish   228 RGSLGLSIGIEQPVGHVDIYPNGGSFQPGCNLRGALEKMASYGIFAINNAIRCEHERSIHLFIDS 292

  Fly   296 I 296
            :
Zfish   293 L 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 74/261 (28%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 74/261 (28%)
Pancreat_lipase_like 51..347 CDD:238363 74/261 (28%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.