DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VGlut and CG7091

DIOPT Version :9

Sequence 1:NP_001245848.1 Gene:VGlut / 33427 FlyBaseID:FBgn0031424 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_650243.2 Gene:CG7091 / 41590 FlyBaseID:FBgn0038099 Length:509 Species:Drosophila melanogaster


Alignment Length:431 Identity:106/431 - (24%)
Similarity:192/431 - (44%) Gaps:64/431 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 WTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHG----- 192
            ||...|......:::||:|:....|::|.:..:.::|.:|::..|..::.:|   .:.|.     
  Fly   105 WTRNQELTFPGVYYYGYVVSISLSGYLADRCSSKRLFIVSLIFEAVAYILLP---AMAHSSFEAG 166

  Fly   193 --HVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAV 255
              .:|||     ||..|...||.:.::..||.|.||:.|.:.|:||...|.::..|::..|:: .
  Fly   167 VVDLVIC-----GLLAGCGNPAMYKLFVTWAHPTERTALLSFAYSGLLMGSMLVYPVASYLSN-F 225

  Fly   256 GYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYI---EKSLGESAHPTMPSLKTTPW 317
            |::..||..|..|:.:.:...:|.::...:||.||..|:.|:   :..||:...|.:    |.||
  Fly   226 GWELSFYVVGGVGLSFGIACCFLVYDTVEQHPRISNEEVDYLRQGKSQLGQQRQPVV----TIPW 286

  Fly   318 REMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHL------IMTTI 376
            :.::.:.||||.|:.:...::.|.::|.....|::....|.:.|.||:.:.|:|      :|..:
  Fly   287 KSLLAAPPVYAFILTHMFHTYTFLVIVQLMPRFMREAMEFDLREVGFLSAAPYLGGICSKVMCIL 351

  Fly   377 VPFGGMLADHLRKNG---------------ILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGA 426
               ||...:  |:.|               ||:|:.:            |:..|...........
  Fly   352 ---GGSYVE--RRVGPDQNCVRRMLYGICSILTTSLI------------GVIILANCDDKILVLV 399

  Fly   427 MFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWT 491
            |||........||  |||....|..||.:|.:|.||:||:..|:|.:.|:.:..|:.......|.
  Fly   400 MFAFMMATTDMGF--SGYWPTLLYFAPSFAGLLSGLANGMAHLSGFLAPHLVAALVHTGSKDEWN 462

  Fly   492 TVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKVWAP 532
            .|.......:.:....:...:|..|||| :|.:..:|..:|
  Fly   463 VVLMTLIVFNTMAMLVFAFCSSTNLQPW-DPRSRMEKTASP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VGlutNP_001245848.1 MFS 98..512 CDD:119392 98/409 (24%)
MFS_1 101..475 CDD:284993 94/372 (25%)
CG7091NP_650243.2 2A0114euk 77..498 CDD:129972 104/425 (24%)
MFS 115..482 CDD:119392 95/398 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.