DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VGlut and MFS1

DIOPT Version :9

Sequence 1:NP_001245848.1 Gene:VGlut / 33427 FlyBaseID:FBgn0031424 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster


Alignment Length:405 Identity:120/405 - (29%)
Similarity:194/405 - (47%) Gaps:19/405 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NWTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVI 196
            :|.....|::.|||||||::||..||::..::.|.....:|.:.||.|.:.:|:.::........
  Fly    56 DWNEMERSYILSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYC 120

  Fly   197 CVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLL-ADAVGYQAP 260
            .:|:..|||:|..:|..|.....|.|..||:||..||.:|...|.:|.:..|||| |.::|:...
  Fly   121 AIRMSMGLFQGFLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAASSIGWPGI 185

  Fly   261 FYAYGVFGIIWYMFWIWLCFEN-PRKHPAISIPELKYIEKSLGESAHPTMPSLKTT-----PWRE 319
            ||.....|::|.:.| |:...| ||:...|...||.|||.|:..|.......||.|     ||:.
  Fly   186 FYVSCGVGVLWCIVW-WIFGANQPRESKFIGEAELNYIETSINSSRKAEEAELKATGPIPVPWKA 249

  Fly   320 MMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLA 384
            :..|:|.:|::|...|:||.:..|.....:::.......::......:||:|....:.....::|
  Fly   250 IWTSVPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIA 314

  Fly   385 DHLRKNGILSTTNVRKLFNCGGF-----GMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGY 444
            |.|...||:|.|.:||..|...|     .:.|:.||   .::..|.|:..:...|..:..:..|.
  Fly   315 DILLTRGIMSITGIRKSVNSIAFFVPAAALIGVSFL---DNTQKTLAVVLMCANVGINAGSTIGS 376

  Fly   445 NVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLI--QANPTGCWTTVFTLAACVHLVGCTF 507
            .:|.:|::|.:|.||||:.|....:..|:.| .|.|:|  ..:....|..||.::|.:..||...
  Fly   377 TINTIDLSPNHAGILMGIVNTASNIVPILTP-LLVGIIVKDDHDREQWQIVFIISAVIFCVGNIV 440

  Fly   508 YGIFASGELQPWAEP 522
            |..|.....|||..|
  Fly   441 YVAFGKMVNQPWDAP 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VGlutNP_001245848.1 MFS 98..512 CDD:119392 115/393 (29%)
MFS_1 101..475 CDD:284993 104/354 (29%)
MFS1NP_726254.1 MFS 18..444 CDD:119392 115/392 (29%)
2A0114euk 19..456 CDD:129972 120/405 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451944
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.