DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eogt and POMGNT2

DIOPT Version :9

Sequence 1:NP_001259934.1 Gene:Eogt / 33424 FlyBaseID:FBgn0264672 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_116195.2 Gene:POMGNT2 / 84892 HGNCID:25902 Length:580 Species:Homo sapiens


Alignment Length:422 Identity:100/422 - (23%)
Similarity:163/422 - (38%) Gaps:78/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GDSSLEC---THYLRFCRGRNLLFDFRGLEQREERIRYH--MDVLGPGQLLGHCKLNRTRLSGEM 184
            |.:.:.|   ||..|.||.:.|.:.    .:.||.|.:|  ..|:.|.  ||..:.....|.   
Human    63 GGTHMVCTGRTHTDRICRFKWLCYS----NEAEEFIFFHGNTSVMLPN--LGSRRFQPALLD--- 118

  Fly   185 EHIGSALQSWGPELRNFDVLPHPVLESGLCDVVVNTPTFIMKI---------DATYNMYHHFCDF 240
               .|.::....:..||..||...|.      .:..|.|:..:         |...:::|.  |.
Human   119 ---LSTVEDHNTQYFNFVELPAAALR------FMPKPVFVPDVALIANRFNPDNLMHVFHD--DL 172

  Fly   241 FNLYASL--FVNQSHPAAFNTDVQILIWETYPYDSPFRDTFKAFSQRPVWTLSDVE--GKRVCFK 301
            ..|:.:|  |...:|.|      ::...|.:...:.| |.:|..|.:.....:.::  |:.:||.
Human   173 LPLFYTLRQFPGLAHEA------RLFFMEGWGEGAHF-DLYKLLSPKQPLLRAQLKTLGRLLCFS 230

  Fly   302 NVVLPLLPRMIFGLFYNTPIIQG-------CSNSGLFRAFSEFILHRLQIPYK--PPQQKIRITY 357
            :..:.|..   ...:|....:|.       ..:....|.|:.|:..:|.:.:.  |..::..:.:
Human   231 HAFVGLSK---ITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVF 292

  Fly   358 LSRRTKYRQVLNEDELLAPLEANDKYDVQRVSYERLPFTNQLAITRNTDILIGMHGAGLTHLLFL 422
              .||:.|.:|||.|||..|....:.....||.|...|.:.:.:..|..:|:.||||.|...|||
Human   293 --SRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASMLVSMHGAQLVTTLFL 355

  Fly   423 PNWACIFELY----NCEDPNCYKDLARLRG--VRYRTWEQRDLVYPQDEGHHPEGGAHAKFTNYS 481
            |..|.:.||:    |.:....||.||.|.|  ::|..|..   :.|::...|||         ..
Human   356 PRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRN---MMPENTVTHPE---------RP 408

  Fly   482 FDVKEFVHLVDGAAEEILSHKEFPRR-ASENP 512
            :|.....||.......||..:|.||. ...||
Human   409 WDQGGITHLDRAEQARILQSREVPRHLCCRNP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EogtNP_001259934.1 DUF563 232..454 CDD:282442 59/240 (25%)
POMGNT2NP_116195.2 DUF563 <264..395 CDD:309636 42/132 (32%)
FN3 493..580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4698
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.